KEGG   Ruegeria sp. TM1040: TM1040_0013Help
Entry
TM1040_0013       CDS       T00359                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sit  Ruegeria sp. TM1040
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sit00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
14274..15071
Genome map
AA seq 265 aa AA seqDB search
MNYDDLVVVMRRLALEAGDKIMEIYNSDDFDVKQKSDDSPVTVADEAADALISAGLRSAF
PDVMLVTEEQAESHSATGDTFLIVDPLDGTKEFINRRGDFTVNIAYVEAGVPTRGVVYAP
ARDRMFYTLADGSAVEEKGPFSKNEVGETTALKVAESDNSALLVVASKSHRDQATDDYIN
KYSVKDTRSAGSSLKFCLVATGEADLYPRVGRTMEWDTAAGHAVLSGAGGRVVRFDDHNP
LRYGKDGFANPFFIAHAPAVELKDA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaattatgatgatctggtagtggtgatgcggcgcttggctctggaagcgggtgacaag
atcatggagatctacaactccgatgatttcgacgtgaagcagaaatcagacgatagccct
gttaccgttgcggacgaggcggcagacgcattgatctcggcggggctgcgctcggctttt
cctgacgtgatgctcgtcaccgaagagcaagccgagtctcatagcgcaacaggcgataca
ttcctgattgttgaccctctggacggcaccaaggaattcatcaatcgccgtggcgacttc
accgtcaatatcgcctatgtcgaggcaggcgtgcccacgcgcggtgtggtctacgcgccc
gccagagaccgtatgttctacactcttgccgatggatcagcggtcgaggaaaaaggcccc
ttcagcaagaatgaagtgggcgagaccacggcgctcaaagtggctgagagcgacaatagc
gctctgcttgtggtcgcgtcgaaatcccaccgcgatcaggccacagacgattacatcaac
aaatacagcgtgaaagacactcgcagcgcagggtcttcgttgaaattctgccttgttgcg
acgggcgaggccgatctttatccgcgcgttggccgcacgatggagtgggatacggcggca
gggcatgctgttctttcgggcgctggtggccgcgttgtgcgttttgatgatcacaacccg
ctgcggtacggcaaggacggatttgcgaacccgttctttatcgcccacgcgcctgcggtc
gagttgaaagacgcgtaa

DBGET integrated database retrieval system