KEGG   Ruegeria sp. TM1040: TM1040_0015Help
Entry
TM1040_0015       CDS       T00359                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sit  Ruegeria sp. TM1040
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TM1040_0015
   00052 Galactose metabolism
    TM1040_0015
   00500 Starch and sucrose metabolism
    TM1040_0015
   00520 Amino sugar and nucleotide sugar metabolism
    TM1040_0015
Enzymes [BR:sit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TM1040_0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
16023..16916
Genome map
AA seq 297 aa AA seqDB search
MPRKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEARAAGIKEFIFVTSR
GKGALEDYFDHAPVLEQELRKKGKDQLLEVLKATNMGSGDIAYIRQHKALGLGHAVWCAR
RLIGDEPFAVMLPDDVIAADKPCLQQMVEAYAETGGNMVAAMEVAPEKTSSYGILDVKDS
KDAVMPINAMIEKPSPEEAPSNLAVIGRYILSPSVLQNLNKRKQGAGGEIQLTDAIAEDI
ARDVPVCGYRFKGRRFDCGSKSGFLQATVAFALEREELRDDLMEYLSTLSAHRQAAE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcctagaaaagttacaaaagctattttccctgttgccggtcttggcacgcgttttttg
cctgccacgaagtctgtgcccaaagagatcatgactctcgttgaccggcctctcgtgcaa
tatgccatcgacgaggcgcgcgctgctggcatcaaggaattcatctttgtgacatctcgc
ggcaaaggagcgcttgaagactatttcgaccacgcgcctgttctggaacaggaactgcgc
aaaaagggcaaggatcagcttctcgaagttctcaaggcgaccaatatgggatcaggagat
attgcctatattcgtcagcacaaggcgctgggcttgggccatgcggtctggtgcgcgcgc
cgtctgatcggggatgagccatttgcggtgatgctgcctgacgatgtgatcgcggccgac
aagccctgccttcagcagatggtcgaagcctatgctgaaaccggcggcaacatggtggca
gcgatggaagttgcgccagagaaaacgtcgtcttacgggatcctcgacgtcaaggatagc
aaggatgccgtgatgccgatcaatgcgatgatcgaaaagccgagccccgaagaagcgccc
tcgaacctcgcagtgatcgggcgttatattttgtcgccttcggtgcttcagaatctcaat
aagcgcaaacaaggggcgggcggggagatccaactgaccgacgcgattgcggaggatatt
gcgcgggacgtgccggtttgtggctaccgtttcaaagggcgccgctttgattgtggctcc
aagtctgggttcttgcaggctacggtcgcctttgcgttggaacgtgaagaactgcgcgat
gatctcatggagtatctttcgaccctgtcggcccatcgacaggctgctgaataa

DBGET integrated database retrieval system