KEGG   Ruegeria sp. TM1040: TM1040_0040Help
Entry
TM1040_0040       CDS       T00359                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00010  Glycolysis / Gluconeogenesis
sit00071  Fatty acid degradation
sit00350  Tyrosine metabolism
sit00625  Chloroalkane and chloroalkene degradation
sit00626  Naphthalene degradation
sit01100  Metabolic pathways
sit01110  Biosynthesis of secondary metabolites
sit01120  Microbial metabolism in diverse environments
sit01130  Biosynthesis of antibiotics
sit01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM1040_0040
  Lipid metabolism
   00071 Fatty acid degradation
    TM1040_0040
  Amino acid metabolism
   00350 Tyrosine metabolism
    TM1040_0040
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TM1040_0040
   00626 Naphthalene degradation
    TM1040_0040
Enzymes [BR:sit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TM1040_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C UDPG_MGDP_dh_N TrkA_N Methyltransf_25 ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: ABF62773
JGI: TM10400040
RoseoBase: TM1040_0040
UniProt: Q1GKP3
Position
42535..43575
Genome map
AA seq 346 aa AA seqDB search
MKAVLYETFKELPKLVTVEDPTPDPDGVVIKVEATGLCRSDWHGWMGHDSDIVLPHVPGH
EFAGVIVALGKNVRNWTVGDRVTVPFISGCGACSECHAGHQQVCHNQQQPGFTHWGSFAE
YVGVRQADLNLVALPQEMDFATAASLGCRFATSFRAVVDQAQTRAGQWVAVHGCGGVGLS
AVMIAQAVGANVIAIDIDDEKLNLAQELGAVATINGARVADVPEAVIDLSRGGAHVSLDA
LGHPLTCFNSIQNLRPRGKHVQVGLMLAEHSTPSVPMAKVIAKELEILGSHGMQAHRYDA
MLDMIASGKLDPRRLVGREISLDAAPSALVKMDQFQSIGATVITTF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtcctctatgagacctttaaggagttgccaaaactggtcacggtcgaggat
cccaccccggatccggatggcgtggtgatcaaggtcgaggccaccgggctctgccgctca
gactggcatggctggatggggcatgacagcgacatcgtgctaccgcatgtgcccggccat
gaatttgcaggtgtgattgtggccttggggaagaatgtccgcaactggacggttggggat
cgcgtgaccgtgccattcatctctggatgcggagcctgttcggagtgtcacgccggccac
cagcaggtttgccacaaccagcaacagcctggatttacccattgggggtcttttgcggaa
tatgtgggggtccgtcaggccgatctgaacctcgtggcgctgccacaggaaatggatttt
gccaccgcagcaagtcttgggtgccgctttgccacctcctttcgcgcagtggtcgatcag
gcccaaacgcgggccggacaatgggttgcggtgcatggatgcggtggcgtgggattgtct
gcggtgatgattgctcaggcggttggcgccaatgtgatcgccattgatatcgacgacgaa
aaactcaatctcgcccaagaactcggagccgttgcgactatcaatggtgcgcgcgtggcc
gatgtcccagaggcggtgatcgacctcagcagaggcggcgcgcatgtctcgctggatgca
ctgggccacccgttgacctgcttcaactcgatccagaacctgcgccctcgcggcaaacac
gtgcaggtgggcttgatgctcgcagagcacagcacgccgtcggtgccgatggcgaaagtc
attgcaaaagagttggagatcctcggatcccacggcatgcaagcgcatcggtacgacgcc
atgctggatatgatcgcatccggaaaacttgatcccaggcggcttgtggggcgtgaaatc
agcctcgatgcggccccctccgcccttgtgaagatggatcagttccaatcgatcggcgcg
acggttatcaccaccttctga

DBGET integrated database retrieval system