KEGG   Ruegeria sp. TM1040: TM1040_0206Help
Entry
TM1040_0206       CDS       T00359                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sit  Ruegeria sp. TM1040
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TM1040_0206
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TM1040_0206
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TM1040_0206
Enzymes [BR:sit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TM1040_0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RoseoBase: 
UniProt: 
Position
223721..224980
Genome map
AA seq 419 aa AA seqDB search
MAEDLINSFMNGPDENGRFGIFGGRFVSETLMPLILSLEEEYEKAKVDPDFWAEMDDLWK
NYVGRPSPLYFAERLTNHLGGAKVYMKRDELNHTGAHKVNNVLGQILLARRMGKTRIIAE
TGAGQHGVATATVCAKFGLKCVVYMGAHDVRRQAPNVFRMRLLGAEVIPVTSGRGTLKDA
MNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQSVIGKEVRWQLAEQEGEGRLPDTV
IAAIGGGSNAMGLFHPFLDDPSVNIIGVEAGGKGVDEKMEHCASLTGGRPGVLHGNRTYL
LQDDDGQILEGFSISAGLDYPGIGPEHAWLHETGRAQYVSITDKEALEAFQLSCAMEGII
PALEPSHALAHVTKIAPELPKDHIIVMNMCGRGDKDIFTVARHLGFDMSDTEEGRDLEE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagatctcatcaatagcttcatgaacgggccggacgaaaacggtcggtttggc
atctttggcggccgctttgtcagcgagacactgatgccgctgatcctgagcctcgaagag
gaatacgaaaaggccaaggtggatccggatttctgggcggaaatggatgatctgtggaag
aactatgtgggccgcccgagcccgctctatttcgccgagcgcctgaccaatcatctgggc
ggcgccaaggtctacatgaagcgtgacgagctcaatcacaccggcgcgcataaagtgaac
aatgtgctgggtcagatcctgctcgcccgccgcatgggcaagactaggatcatcgccgaa
accggtgctggccagcatggggttgcgaccgccactgtctgtgccaagtttggtctgaaa
tgcgtggtctacatgggcgctcatgacgtacgtcgacaggcgcccaacgtgttccggatg
cgtcttcttggcgctgaggtgatcccagtcacctctggccgtggcacgctcaaggatgcg
atgaacgacgcgctgcgggactgggtcaccaatgtgcgcgacacattctactgcatcggc
accgttgcgggcccgcacccctatccggctatggtgcgcgatttccagtccgtgatcggc
aaggaagtgcgctggcagcttgcagagcaggaaggcgagggccggttgccggacacggtg
attgcggctatcggagggggctccaacgcgatgggcctgttccacccgttcctcgatgac
ccttcggtcaatatcattggcgttgaggccggcggcaaaggtgtggatgagaaaatggag
cattgcgcctcattgacaggcggccggccgggcgtgctgcacggcaaccggacctatctg
ctgcaggacgatgacggccaaatcctcgaaggcttctcgatttcggcgggcctggattac
ccggggatcgggccggagcatgcctggctgcatgagaccgggcgcgcgcaatacgtgtcc
atcaccgacaaggaagccctcgaggcgttccagctgtcctgcgcgatggaggggattatc
ccggcgctcgagccgagccacgcgctcgctcatgtcactaagatcgcaccagaactgccc
aaggaccacatcatcgtgatgaacatgtgtgggcgtggcgacaaggacatctttaccgta
gcccgccacctcgggtttgatatgtcagacaccgaagagggccgcgacctcgaagagtga

DBGET integrated database retrieval system