KEGG   Ruegeria sp. TM1040: TM1040_0222Help
Entry
TM1040_0222       CDS       T00359                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sit  Ruegeria sp. TM1040
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TM1040_0222
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TM1040_0222
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TM1040_0222
Enzymes [BR:sit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TM1040_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(237554..238408)
Genome map
AA seq 284 aa AA seqDB search
MKFRHIRQATEIEKGLHMTRPTTRIDAKFAELAAAGKKAFVTYVMAGDPDYDTSLEVVKG
LPAAGVDVIELGLPFTDPMADGETIQLAGQRALEAGMTLERTLQLARDFRKEDDTTPIVL
MGYYNPIYSRGVETFLSDAKEAGIDGLIVVDLPPEEDSELCLPAQAAGLNFIRLATPTTD
DARLPRVLQNTSGFVYYVSITGITGAAEAEAADVGPEVARIKAATDLPIIVGFGIKTPER
AQTIASISDGAVVGSAIVAEIGAGKSPAEVLAFVKTLADGAHAG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtttcggcacatcaggcaggcaacagagatcgaaaaaggccttcatatgacccgc
ccaaccacacgcatcgacgctaagtttgctgaactcgctgccgcgggcaaaaaggccttc
gtcacctatgtcatggcgggcgatcccgactacgacacctctttggaggtggtcaaaggc
ctgcccgccgctggcgtcgatgtgatcgagctcggcttgccctttaccgatccgatggcg
gacggcgaaaccatccagctcgcaggtcagcgcgcgctggaggccggaatgacgctggag
cgcacactgcagctggcgcgggattttcgcaaggaggatgacaccacgccaatcgtgctg
atgggctactacaacccgatctactcgcgcggtgtcgagacattcctcagcgatgcaaaa
gaggccggcatcgacggtttgatcgtggtggatctgccgccagaagaagacagcgaactc
tgcctgcctgcacaagcggcggggctgaacttcattcgtcttgcgacccccaccaccgat
gatgctcgtctgccacgcgtgctgcaaaacacatccggttttgtctactatgtgtcgatc
acagggatcaccggcgccgccgaggcagaggccgcggacgtcgggcccgaagtggctcgc
atcaaggcggccacggatctgccgatcatcgtggggttcgggatcaaaacgccggaacgg
gcgcagaccatcgcttcgatctcggatggggccgtcgttggcagcgccatcgtggccgag
atcggagccgggaaatcacctgccgaggtgctggcctttgtaaaaacactggcggatggc
gcccacgcgggctga

DBGET integrated database retrieval system