KEGG   Ruegeria sp. TM1040: TM1040_0363Help
Entry
TM1040_0363       CDS       T00359                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sit  Ruegeria sp. TM1040
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TM1040_0363
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM1040_0363
   00052 Galactose metabolism
    TM1040_0363
   00500 Starch and sucrose metabolism
    TM1040_0363
   00520 Amino sugar and nucleotide sugar metabolism
    TM1040_0363
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TM1040_0363
   00524 Butirosin and neomycin biosynthesis
    TM1040_0363
Enzymes [BR:sit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TM1040_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
372959..373921
Genome map
AA seq 320 aa AA seqDB search
MWNLIADVGGTNMRLAAVNAEGEILEQARYDSKGTQNLEEACADFAAHRGSAPGRAVIAA
AGVVRGGSVQLTNANQSFSERGIAVALQTERVKVLNDFEAAAWSLASVSAGDVTVLQGQA
VFPKEPCLIIGPGTGLGVGALIWANGEPCVVPGEGGHVAIGPRTADEVAIFEALREEWPE
IGMGPGLAVEAEGILSGTGLPYFYRAVARSMELTAPLTTGAEIFQSAQARLDTAAVRAVS
LFAQYLAGVAGDLGLVFAAKGGVFVTGGVAAANPWIFDAAFVEAFNAGGRHTAWREELPL
HLYHQPNFGLIGARNYLRAR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatctgatcgctgacgtcggcggaacaaacatgcggctggcggccgtgaatgcg
gagggggagatcctcgagcaagcccggtatgacagcaagggcacgcagaaccttgaagag
gcctgtgcagattttgcagcccatcgcggcagcgcgcctggccgtgccgtcattgcggcg
gcaggtgtggtgcggggcggctccgttcagttgaccaacgccaaccagagtttttccgaa
cgcgggattgccgtagccctgcaaaccgagcgggtcaaagttctgaatgactttgaagcc
gctgcctggtcactggcttcggtgagtgcgggggatgtgaccgtgctgcaggggcaggcg
gtgtttcccaaggaaccctgtctgatcatcggcccgggcaccgggcttggcgtgggggcc
ctgatttgggccaatggcgaaccctgcgttgtccccggcgaaggggggcatgttgccatc
ggcccgcgcacggccgatgaggtcgcgatctttgaggcgttgcgcgaggaatggcccgag
atcggcatggggccggggcttgcggtagaggccgaaggcatcctctcgggcacagggttg
ccttacttttaccgcgcggttgcgcgcagcatggagctgaccgcgccgctcacgactggg
gcggagatttttcagtccgcgcaggcccggctcgacaccgcagcggtgcgtgcggtgtcg
ctctttgcgcagtatctcgccggagtcgcgggggatctcggtctcgtcttcgcggccaaa
gggggcgtgttcgtcaccgggggcgttgccgccgcaaacccgtggatctttgatgcggcc
tttgtggaggcgttcaacgcgggtgggcgccacaccgcgtggcgcgaagagctgccgctg
catctctatcatcagcccaatttcggcctgatcggcgcgcgcaattatctgcgcgcccgc
tga

DBGET integrated database retrieval system