KEGG   Ruegeria sp. TM1040: TM1040_0404Help
Entry
TM1040_0404       CDS       T00359                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
sit  Ruegeria sp. TM1040
Pathway
sit02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sit00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TM1040_0404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 Cytochrom_C Cytochrome_CBB3 Cytochrom_D1
Motif
Other DBs
NCBI-ProteinID: ABF63137
JGI: TM10400404
RoseoBase: TM1040_0404
UniProt: Q1GJM9
Position
413522..414805
Genome map
AA seq 427 aa AA seqDB search
MLRRLALGLLLCAASGVSAEEFQTLKGHGGPIMALAVNDRGHVASASFDNSVSLWQEGAP
SWLEAHEAAATVVAFGPDDTLFSAGDDFVIYRWQQGHPQEIGRHTAKIRALDLSRDGEWL
ASASWDGGIGLWPMSAGTPRRIAVGTGVNDLAFDGAGRLFVATMTGQIQVFDSPEAAPRI
LAEQGFGINRLVLSAAGWLAYGAVDGGTRVINAETGAEIADFTLDRRPILALAHHAESQQ
IAVGDGHGYIMMIDTHDWSIARDFRAMREGPVWALAFSKDGQRVWAGGIHDVIYGWPIAL
MASSPAAGTETRTFLQAPETMPNGERQFMRKCSVCHDLVATEQRRAGPHLAGLFGRPAGS
LPGYRYSDTLAQSDIIWGAETIDALFDLGPDHYIPGSKMPMQRITAPTDRQDLIDYLKTA
TQLSEDN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcgactggctcttggcctgctcctctgcgccgcctctggggtgagcgcggag
gagttccagaccctcaaaggacacggagggccgatcatggcgcttgccgtgaacgatcgg
gggcacgtggccagcgccagtttcgacaattccgtctcactctggcaggagggggcgccg
agctggctcgaggcacatgaagcagccgcgaccgtggtggcctttggccctgatgatacc
ctgttcagcgcaggcgacgactttgtgatttatcgctggcagcagggccacccccaagag
atcggacggcataccgccaagatccgcgccttggacctctcgcgcgatggggaatggctc
gcctccgcaagctgggatggcggcattggtctttggcctatgagtgcgggcacgccccgc
cgcatcgcggttggaacgggcgtgaacgatcttgcctttgacggggccggtcgcctcttc
gtcgccaccatgaccgggcagatccaagtcttcgacagcccggaggctgccccacgaatt
ctggcggaacaagggtttggcatcaaccgtttggtgctctctgctgctggctggctggcc
tatggcgccgttgatggcggcacccgtgtgatcaacgcagaaaccggggccgagattgcc
gatttcaccctcgaccggcggcccatactggcccttgcgcatcatgccgagagccagcag
atcgccgtgggtgatgggcatggctatatcatgatgatcgacacacacgactggagcatt
gcgcgcgattttcgggccatgcgcgaaggccccgtctgggctctggcgttttcaaaggac
ggccagcgggtctgggcaggcggcatacacgatgtgatctatggctggcccatcgcgctg
atggccagcagcccagcggcgggaaccgagacccgcacattcctgcaggcgcctgaaacc
atgcccaatggtgagcgccaattcatgcgaaaatgctcggtttgccacgatttggtcgcc
acagagcagcggcgcgccggtcctcatctggcggggctctttggacgaccggccggcagt
ctgcctggctatcggtattccgacacgctggcgcagtctgacatcatctggggtgccgag
accatcgatgccctgttcgatctcggccctgaccattatattccggggtccaagatgccg
atgcagcgcatcaccgcccccacagatcgccaagatctgatagactatctgaaaaccgcg
acacaactttcggaggataattga

DBGET integrated database retrieval system