KEGG   Ruegeria sp. TM1040: TM1040_0418Help
Entry
TM1040_0418       CDS       T00359                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sit  Ruegeria sp. TM1040
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TM1040_0418
Enzymes [BR:sit01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     TM1040_0418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
428354..430087
Genome map
AA seq 577 aa AA seqDB search
MATSFAARLSQLLTQIYPDLDTEILGSKVVEAFWPEGSHRRKRPRRPGNSLWSERDALLI
TYGNTMRDGAHKPLDLLHDFLLTYMKGVVNGVHILPFFPFTSDDGFAVTDYRKVNPELGD
WADIRRIGGAFHLMSDMVLNHVSSQSAWFNAYRQGQPPYDRFFYEASPSDDLSAVVRPRT
TPLLQEVETATGAKHVWCTFSHDQVDLNFENPEVLLEILRIIRLHIDQGVRIIRLDAVAF
IWKEVGTSSIHLPQTHAIVQLLRLLADYATETVVLLTETNVPRAENLSYFGNRNEAHVVY
NFPLPPLILHAMMAGSARYLLNWARAMPPAPLGCAYLNFTASHDGIGMRPAEGVLPQEEI
DQMIACVRAVGGLVSMRALPGGGEAPYEVNCTYFDALGRTFDRGEARKVDRFICAQTIPM
SLEGIPAFYIHAMLATANDHDAVARRGMNRAINRHRWDYGELKARLNDADSAQAQVMSAL
SERLRVRAEQPAFHPNATQFTLQLDDRVFALWRQSLDRAQSIFALHNVSGDGVILHPGAL
NLIEGETWRDLLSGDMFESDAEITLAPYQCRWITNQA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggccacatcctttgctgcacgcctgtcgcaactgctgacccaaatctatccggatttg
gacacggagatccttggctccaaagtggttgaggcgttttggcccgaaggcagtcaccgg
cgcaagcgcccgcgcaggcctggaaattctctttggtcagaacgcgacgcattgctgatc
acctatggcaacaccatgcgtgatggggcgcataagccgttagacctgctgcatgatttc
ctgctgacttatatgaagggtgttgtgaatggcgtgcatatcctgccgttttttcccttc
acttcggacgacgggtttgccgtcacggactatcgcaaggtgaatcctgagctgggtgat
tgggccgacattcgccggatcggcggcgcgtttcacctgatgtctgacatggtgctcaac
catgtgtcctcgcagagcgcctggttcaacgcctaccggcaggggcagccgccttatgac
cgcttcttctacgaggcttcgccctcggacgatctgagcgcagtggtgcgtccacgcaca
acgccgctgctgcaggaggtagagacagccacgggcgcgaaacatgtgtggtgcaccttc
agccacgatcaggttgatctcaattttgagaacccggaggtcctgctggaaatccttcgg
atcattcgcctgcatatcgatcagggggtccgcattatccggctcgatgcggtggccttt
atatggaaagaggttgggaccagttcgatccacctgccgcaaacccatgcgattgtacag
ctgctgcgcctgctggcagattatgcgaccgagacggtggtactgctgaccgagaccaac
gtgccgcgggctgagaatctcagctactttggcaatcgcaacgaggcccatgtggtctat
aattttccgctgccgccattgatcctgcacgcgatgatggcgggctcggcgcgctacctg
ctgaattgggcacgggcgatgccgccggcgcccctgggatgcgcctatttgaatttcacc
gcgagccacgatggaatcgggatgcgcccggcggagggggtgttgccgcaggaggaaatc
gaccagatgatcgcctgcgtgcgggcggtagggggtcttgtgtccatgcgggccttgccg
gggggtggtgaagcgccctacgaggtgaactgcacctattttgacgcgcttggccgaacc
tttgacaggggcgaagcgcgaaaggtggatcgattcatctgtgcgcagaccattcccatg
agccttgagggaattccggcgttttacattcacgcgatgctggcgacggccaatgatcat
gatgcggtggcgcggcgcggtatgaaccgggcgatcaaccgccaccggtgggattacggc
gagctgaaggcgcgtctgaatgacgcggacagcgcgcaggctcaggtgatgtcggcgctc
tccgaacggctgcgggtccgggccgagcagccggcgtttcaccccaatgctacccagttc
actttgcagctggatgatcgtgtctttgcgctctggcggcagtcgctggaccgggcgcag
tcgatctttgcgctgcacaatgtcagcggagatggggtgatcctgcatcccggcgcgctg
aaccttattgaaggtgagacatggcgggatctgttgtccggtgacatgtttgaaagcgat
gcagagatcacactggcaccctatcaatgccgttggatcaccaatcaggcttga

DBGET integrated database retrieval system