KEGG   Ruegeria sp. TM1040: TM1040_0570Help
Entry
TM1040_0570       CDS       T00359                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sit  Ruegeria sp. TM1040
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TM1040_0570
Enzymes [BR:sit01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TM1040_0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(607521..608468)
Genome map
AA seq 315 aa AA seqDB search
MAETAPAPYFSEIARGPDQVEAHWLTTQDGQRIRAGLWRSHGPSAGTILLFPGRTEYIEK
YGPLAIDLTDRGFDVLTVDWRGQGLADRSLSDGRLGHVAEFGAFQLDVAALVAHAEALNL
PRPWYLLGHSMGGAIGLRALHEGLPVAACAFTAPMWAIRIPFALRPAARLLARFGTALGV
SEKLVPTTTIEQYVQVTPFEGNTLTNDPEMYAFLQMQMTQHPELALGGPTVQWLSQAMLE
CADLRARPSPDVPCVTFLGENEQIVATEAIHDRMARWPSGKLEMIPDAQHEILMEIPQTR
RQTCAILTAHFKKHV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaccgcccccgcgccctatttcagcgagattgcgcgcggcccggatcaggtc
gaggcccattggctgaccactcaggatggtcagcgtatccgcgcaggcctctggcgtagc
cacggtccttctgcgggcacaatcctgctgtttcccggtcgcacagaatacatcgagaaa
tatggcccactggccattgacctgacggatcggggttttgacgtcctgaccgtggactgg
cgcggacaggggcttgcggatcgcagcctgagcgatggccgcctcgggcatgttgcagaa
tttggcgcgttccagctcgacgtggcggcgctggtggcgcatgccgaggccctcaacttg
ccacgcccgtggtatctgctgggacattccatgggcggcgccatcggcctgcgggctctc
cacgagggtctgccagttgcggcctgcgccttcactgccccgatgtgggcgatccgcatt
ccctttgcgctgcgaccggctgcccggcttttggcgcggtttgggacggcgctgggtgtg
agcgagaagctggtgcccacaaccaccatcgaacaatacgtccaggtcacaccctttgag
ggcaacacgctgacaaatgacccggaaatgtacgctttcttgcagatgcagatgacccag
caccccgaattggccctcggggggccgacggtacaatggttgtctcaggccatgctggag
tgcgcagatctgcgcgcgcgcccctcacccgatgtgccttgcgtgacctttctgggggaa
aacgaacagatcgtcgccacagaggccattcatgatcgcatggcacgctggccatcaggc
aagctcgagatgatcccggacgcccagcacgaaatcctgatggaaatccctcagacacgc
aggcagacctgcgccatcctgacggcgcacttcaaaaaacacgtctag

DBGET integrated database retrieval system