KEGG   Ruegeria sp. TM1040: TM1040_0626Help
Entry
TM1040_0626       CDS       T00359                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sit  Ruegeria sp. TM1040
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sit00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(664038..664640)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTVLLQASHNYRENNMQTYLLTARIDDRAGTGRIASRIGISAEAD
MFAPEDDLFGKIETRLKDGPVAAIFVDEAQFLTHEQVWQLARVVDDLGVPVLAFGLRVDF
QGNLFPGSASLLALADEMREVRTICHCGKKATMVVRQDATGQVLTEGDQVQIGGNESYIS
LCRRHWRAAMGDLPTAKTLG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttcaactactcgaccatgaacgccggcaagtccacggtcctgctg
caagcgtctcataactatcgcgagaacaacatgcagacctacctgctgaccgcgcgcatc
gacgaccgcgccggaacgggtcggattgcctcacgcattggcatcagcgcagaggcagat
atgtttgcgcccgaagatgacctctttggcaaaatcgaaacccgcctcaaggatgggcct
gtggcggcgatctttgtggatgaggcgcagtttctgacgcacgagcaggtctggcagctg
gcccgcgtcgtcgatgatctgggtgtgccggtgctggccttcgggcttcgtgtggatttt
cagggcaatctgtttcccggctctgcaagcctgctggcccttgccgacgagatgcgcgaa
gtgcgcaccatctgccattgcggcaaaaaagcaaccatggtggtgcgtcaggacgcgaca
ggccaggtcctgaccgaaggggaccaggtacagattggcggcaacgaatcttatatctcc
ttgtgccgccgccactggcgcgccgcgatgggggatctccccaccgctaaaacactggga
tag

DBGET integrated database retrieval system