KEGG   Ruegeria sp. TM1040: TM1040_0626Help
Entry
TM1040_0626       CDS       T00359                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sit  Ruegeria sp. TM1040
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TM1040_0626
Enzymes [BR:sit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     TM1040_0626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(664038..664640)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTVLLQASHNYRENNMQTYLLTARIDDRAGTGRIASRIGISAEAD
MFAPEDDLFGKIETRLKDGPVAAIFVDEAQFLTHEQVWQLARVVDDLGVPVLAFGLRVDF
QGNLFPGSASLLALADEMREVRTICHCGKKATMVVRQDATGQVLTEGDQVQIGGNESYIS
LCRRHWRAAMGDLPTAKTLG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttcaactactcgaccatgaacgccggcaagtccacggtcctgctg
caagcgtctcataactatcgcgagaacaacatgcagacctacctgctgaccgcgcgcatc
gacgaccgcgccggaacgggtcggattgcctcacgcattggcatcagcgcagaggcagat
atgtttgcgcccgaagatgacctctttggcaaaatcgaaacccgcctcaaggatgggcct
gtggcggcgatctttgtggatgaggcgcagtttctgacgcacgagcaggtctggcagctg
gcccgcgtcgtcgatgatctgggtgtgccggtgctggccttcgggcttcgtgtggatttt
cagggcaatctgtttcccggctctgcaagcctgctggcccttgccgacgagatgcgcgaa
gtgcgcaccatctgccattgcggcaaaaaagcaaccatggtggtgcgtcaggacgcgaca
ggccaggtcctgaccgaaggggaccaggtacagattggcggcaacgaatcttatatctcc
ttgtgccgccgccactggcgcgccgcgatgggggatctccccaccgctaaaacactggga
tag

DBGET integrated database retrieval system