KEGG   Ruegeria sp. TM1040: TM1040_0652Help
Entry
TM1040_0652       CDS       T00359                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/subunit
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sit  Ruegeria sp. TM1040
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM1040_0652
   00030 Pentose phosphate pathway
    TM1040_0652
   00051 Fructose and mannose metabolism
    TM1040_0652
   00052 Galactose metabolism
    TM1040_0652
   00500 Starch and sucrose metabolism
    TM1040_0652
   00520 Amino sugar and nucleotide sugar metabolism
    TM1040_0652
  Nucleotide metabolism
   00230 Purine metabolism
    TM1040_0652
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TM1040_0652
Enzymes [BR:sit01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TM1040_0652
    5.4.2.8  phosphomannomutase
     TM1040_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(698293..699789)
Genome map
AA seq 498 aa AA seqDB search
MTKPLPEVTPNSWSFLRDAMIKPTGFREYDARWKYPEEINLPGMTALGLGLGTQMIRRGI
APVIAVGNDYRDYSLAIKNALILGLMQAGIKVKDIGPALSPMAYFAQFHLDVPAVAMVTA
SHNPNGWTGVKMGFDRPLTHGPDEMSELRDIVLNGEGERREGGSYEFVEGVKEAYIDDLV
GDFKMSRPLKVVCATGNGTASAFAPEVFERIGVEVVPSHNALDYTFPHYNPNPEALEMLH
DMSASVKASGADLALGFDGDGDRCGVVDDEGEEIFADKVGVIMARDLSKLHPGSTFVADV
KSTGLFASDPELQKNGVKADYWKTGHSHMKRRVKEIGALAGFEKSGHYFLAEPVGRGYDC
GMRVAVEVCKMLDRNPDMKMSDLRKALPRTWATPTMSPYAADTEKYDILARLVDKLVAKH
DAGELMAGRTIKEVVTVNGARVILDNGSWGLVRASSNTPNLVVVCESSESEDEMRAIFAD
IDAVIRTEPAVGDYDQTI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagccgctgccagaggtgacccccaacagctggagtttcctgcgcgacgccatg
atcaagcccaccggctttcgtgaatatgacgcgcgctggaaataccccgaagagatcaac
ctcccggggatgaccgcgctcggtcttggtcttggaacgcagatgatccgccgtggcatc
gcgcctgtcatcgcagtgggcaatgattatcgcgactactcgctggcgatcaaaaacgcg
ctgatccttggcctgatgcaggccgggatcaaagtgaaggacatcggacctgcgctttcg
cccatggcctattttgcccagttccatctggacgtcccggccgttgccatggtcaccgcc
tcgcacaacccaaatggctggaccggcgtaaagatgggctttgaccgccccctcacccat
ggcccggatgaaatgagtgagctgcgcgacatcgtgctgaacggcgaaggcgaacgccgc
gaggggggctcttacgaatttgtcgaaggcgtcaaggaagcctatatcgacgaccttgtg
ggcgatttcaaaatgtcgcgtccgctcaaggtggtctgcgcaaccggcaatggcaccgcc
tcggccttcgcacccgaagtctttgagcgcatcggcgtcgaggttgtgcccagccacaac
gcccttgattacacgttcccccattacaaccccaaccccgaagcgctggagatgttgcac
gacatgtccgcgagcgtcaaagcctcgggtgctgatctggcgcttggatttgacggcgac
ggcgaccgctgcggcgtggtggatgacgagggcgaagagatctttgcggacaaggttggc
gtgatcatggcccgtgacctctccaaactgcatccgggctccacctttgttgcggatgtc
aaatccacgggcctctttgcctctgacccggaactgcagaaaaacggcgtcaaagccgac
tactggaaaaccggtcacagccacatgaagcggcgggtcaaggaaattggcgccctggct
ggttttgagaaatccggccattatttcctcgccgaaccagtgggacgcggctacgactgt
ggcatgcgcgtcgcggtcgaggtctgcaagatgctcgaccgaaacccagacatgaagatg
tccgacctgcgcaaggcgctgccccgcacctgggcaacgcccaccatgtcgccctatgcc
gcagacaccgagaaatacgacatcctcgcccggctggtcgacaaacttgtcgccaaacac
gacgcaggtgagctcatggcaggccgcaccatcaaagaggtcgtgaccgtgaatggcgcc
cgcgtgatcctcgacaatggctcctgggggctggtgcgcgcgtcctccaacacccccaac
ctcgtggtggtctgcgaaagctctgaaagcgaagacgaaatgcgcgctatctttgccgac
atcgatgcggttatccgcaccgaacccgctgttggcgattacgatcagaccatctga

DBGET integrated database retrieval system