KEGG   Ruegeria sp. TM1040: TM1040_0711Help
Entry
TM1040_0711       CDS       T00359                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sit  Ruegeria sp. TM1040
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TM1040_0711
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TM1040_0711
   00630 Glyoxylate and dicarboxylate metabolism
    TM1040_0711
Enzymes [BR:sit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TM1040_0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(763923..766052)
Genome map
AA seq 709 aa AA seqDB search
MSRIERNGLQVASELVAFVEDQALPGTGVSKEAFWAGLAGLVEGMGDENRALLAKRAEIQ
GQIDAWHLEHRGQPHDAAAYKDFLTEIGYLVPEGPDFEVETQNVDPEIAHVPGPQLVVPI
TNARFALNAANARWGSLYDALYGTDAMGDLPSGSGYDAERGARVIAWGRQFLDETFPLTA
GSWSDVAALQVQDGALAPALKDATQFAGYAGDATSPRRILLKNNGLHAILEIDASGNIGK
GDAANINDITLESALSTIMDCEDSVACVDAEDKVSAYANWLGLMKRDLSEEVSKGGKTFT
RVLNDDLSYTTPTGEASKLKGRSLLLVRNVGHLMTNPAILDSAGREAGEGLMDAMITVMV
AMHDLKSEGGNSLHGSVYVVKPKMHGPEEVAFAVKIFDHVEDALGLPRNTVKIGIMDEER
RTSANLKECIRAAKSRVAFINTGFLDRTGDEIHTSMEAGAMLPKGEMKSTAWIASYEDRN
VDIGLACGLQGRAQIGKGMWAMPDRMGEMLDAKIGHPKSGATCAWVPSPTAATLHATHYH
KVDVLSRQNELKAEGARGTLDDLLTIPVMAGQNLSDEAITREIENNAQGILGYVVRWVDQ
GVGCSKVPDINDVGLMEDRATCRISSQALANWLHHGVVSEQQVMAAMQKMAAVVDGQNAA
DPSYRPMAPGFDGIAFQAACDLVFKGRIQPSGYTEPVLHARRLELKAQG
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgagccggattgaacgcaatggacttcaggtcgcctccgaactggtggcttttgtagag
gaccaggcgctgccgggcaccggcgtcagcaaggaggcgttctgggccgggcttgcgggg
ctggtcgagggtatgggcgatgaaaaccgcgcccttcttgccaaacgtgcggagattcag
ggacagatcgacgcctggcatctggaacaccgtggccagccgcatgatgccgcagcctac
aaggactttttgaccgagattggctatttggtgccggagggaccggattttgaggtggaa
acccagaatgttgaccccgagatcgcgcatgtacctgggccgcagctggtggttccgatc
accaacgcccgctttgcgctcaatgcagcgaacgcccgctggggcagtctttatgatgcg
ctctatggcaccgatgccatgggcgatcttccgagcggttcgggttacgatgcggagcgt
ggcgcacgggtgatcgcatggggacgtcaattcctcgatgagaccttcccgcttacggcg
ggctcctggtccgatgtggcagcgcttcaggtgcaggatggcgccctcgcgcccgcactc
aaggacgcaacccagtttgcaggctacgctggcgacgcgaccagtccgcgccgcatcctg
ctgaaaaacaacggcctgcacgcgatcctcgagatcgacgcaagcggcaacatcggcaaa
ggcgatgccgccaacatcaacgacatcacgcttgaatcggcgctctcgaccatcatggac
tgcgaggattcggtcgcctgtgtggatgccgaagacaaggttagcgcctatgccaactgg
ctaggcctgatgaagcgcgaccttagtgaagaggtcagcaagggcggcaagacctttacc
cgcgtattgaacgacgacctgtcctacaccacccccaccggcgaggcgtcgaagctcaag
gggcgttctctcctgttggtgcgcaatgtcggccacctgatgacaaacccggccatcctg
gacagtgcgggccgcgaggcgggcgaaggcctgatggatgcgatgatcactgtcatggtg
gccatgcatgacctaaaatccgaaggcggcaactcgctgcatgggtcggtctatgtggtg
aaacctaagatgcacggtcccgaagaggtcgcctttgcggtaaagatatttgatcacgtt
gaagacgcactgggcctgccgcgcaacacggtcaagatcggcatcatggacgaggaacgc
cgcacctcggccaacctcaaggaatgcatccgtgccgcaaaatcgcgggtggccttcatc
aacaccgggttcctcgatcgcaccggcgatgagatccacacctcgatggaagcaggcgca
atgctgcccaagggcgagatgaaatcgaccgcgtggattgcctcttatgaggatcgcaac
gtcgatatcggtctggcctgtggtctgcaggggcgtgcccagattggcaagggcatgtgg
gcgatgcctgaccgtatgggcgagatgctggacgcaaagatcggccacccgaaatccggc
gcaacctgcgcctgggtgccctcgccgaccgctgcgaccctgcatgccacccattatcac
aaggtggatgtcctgagccgccagaacgagctcaaggctgagggcgcgcggggcacattg
gatgatctgctcacgatcccggtaatggcaggccagaacctctcggacgaggccattacg
cgtgaaatcgagaacaacgctcaaggcattctcggatatgtggtgcgctgggtagatcag
ggtgtgggctgctccaaagtgccagacatcaatgatgtggggctgatggaagaccgggcg
acctgccggatctctagtcaggccttggcgaactggctgcatcatggcgttgtctccgaa
cagcaagttatggccgcgatgcagaaaatggccgccgttgtggatggccaaaacgctgcc
gatccttcttatcgcccgatggctcccgggttcgacggcatcgcctttcaggccgcctgc
gatctggtgttcaagggccgcattcagccctccggctatacggagccggtgctgcatgcc
cgccgtctggaactgaaggctcagggctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system