KEGG   Ruegeria sp. TM1040: TM1040_0764Help
Entry
TM1040_0764       CDS       T00359                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00010  Glycolysis / Gluconeogenesis
sit00051  Fructose and mannose metabolism
sit00562  Inositol phosphate metabolism
sit01100  Metabolic pathways
sit01110  Biosynthesis of secondary metabolites
sit01120  Microbial metabolism in diverse environments
sit01130  Biosynthesis of antibiotics
sit01200  Carbon metabolism
sit01230  Biosynthesis of amino acids
Module
sit_M00002  Glycolysis, core module involving three-carbon compounds
sit_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM1040_0764
   00051 Fructose and mannose metabolism
    TM1040_0764
   00562 Inositol phosphate metabolism
    TM1040_0764
Enzymes [BR:sit01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TM1040_0764
Exosome [BR:sit04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TM1040_0764
  Exosomal proteins of bladder cancer cells
   TM1040_0764
  Exosomal proteins of melanoma cells
   TM1040_0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABF63497
JGI: TM10400764
RoseoBase: TM1040_0764
UniProt: Q1GIL9
Position
complement(820756..821496)
Genome map
AA seq 246 aa AA seqDB search
MARKLAAGNWKMNGTGEHLAELENLAQGDLPEGVDVLICPPATLISRAADRAGDIAIGGQ
DCHAKTSGAHTGDLSADMLRDAGATYVIIGHSERRADHGEGDADVRAKTEAAQAAGLVAV
VCIGETLEEREAGTTLEVVGAQLAGSLPDGVTAENTVVAYEPVWAIGTGKVPTLDQIAEV
HDALRADLVARFGAAGKDLPLLYGGSVKPGNAAEIFGVSNVDGALVGGASLKAADFGPII
AALAAS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcaaactcgcggcaggcaactggaaaatgaacggcaccggcgagcacctcgcc
gaacttgaaaaccttgcacagggtgatctgccggagggcgtcgatgtgctgatctgcccg
cccgcaacgctcatctcgcgcgcggccgaccgtgccggtgacatcgcaattggcgggcag
gattgccacgcaaagacgtctggcgcacatactggcgatctgagcgctgacatgcttcgg
gatgcgggggcaacctatgtgatcattggccactcggaacgccgcgccgatcacggcgaa
ggagacgcggatgtgcgcgccaagaccgaggccgctcaggctgcgggccttgtggccgtg
gtttgcatcggtgaaacgctcgaggagcgcgaggctggcaccaccctagaggtggttggc
gcgcagctcgcgggctccctgcccgatggtgtcacggcggagaacacagttgtcgcctat
gaacccgtctgggccatcggcacaggcaaggttcccacgctcgatcagatcgctgaggtg
catgacgctctgcgtgcagatctggtggcgcgctttggtgcagcgggcaaggacctgcca
ctgctctatggtggttccgtgaaaccaggcaatgcagccgagatctttggggtttccaac
gtcgatggcgcgcttgtgggtggcgccagcctaaaggctgcggacttcggccccatcatt
gcggccctcgccgcaagctga

DBGET integrated database retrieval system