KEGG   Ruegeria sp. TM1040: TM1040_0905Help
Entry
TM1040_0905       CDS       T00359                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sit  Ruegeria sp. TM1040
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sit00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sit00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
966827..967888
Genome map
AA seq 353 aa AA seqDB search
MRFGATILDAEGLRLTADEKALFREAAPFGFILFARNIESGDQLRALCDEFREAAGHDCL
ITIDQEGGRVQRLRAPLAREFRPALDHVEAASDPVRAMYLRARLIAAELRDYGIDSNCAP
LADVATAETHPFLRNRCYGSNVESVAAIARACAEGHLDGGVVPVMKHIPGHGRSTMDSHH
DLPHVTAPADLLRAEDFATFAKLRDLPMAMTAHLVYDAFDPRPATLSPVMMEIIRNELGY
DGLVMTDDISMKALWQDAAQDEARTAGGPYPDDEVTWSARLARQSLDAGCDVALFCNSSL
AARAEVVASAGQMTKAAQRRAEAALACRKPPVVLDTEAVEAELSALMGGQVYG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcggggcgaccattctggacgcagaaggactgcgtctcaccgccgatgaaaag
gcgctgtttcgcgaagcagcgccttttggctttattctctttgcgcgcaatatcgagagc
ggcgatcagctgcgcgcgctgtgcgacgagtttcgcgaagccgccgggcatgactgtctg
attacgatcgaccaggaaggcgggcgcgtgcagcggcttcgtgcgccgctggcgcgggag
tttcgcccggcgctcgatcatgtggaggcggcctcggatccggtgagggcgatgtatctg
cgtgcgcgcctcatcgcggcggaactgcgcgactatggcatcgacagcaactgtgcgccg
ctcgctgatgtggcaactgcagagacccatccgttcctgcgcaatcgctgttacggatcc
aacgtcgagagcgtcgccgccattgcccgcgcctgtgccgaaggacatctggatggtggc
gtggtgccggtgatgaagcacatccccggccatgggcgatcaacgatggacagccaccat
gatctgccccatgtgaccgcccccgcggaccttttgcgcgcggaggatttcgcgaccttt
gccaagctccgggatctgccgatggcgatgacggcgcatctggtctacgacgcctttgat
ccgcgcccggcgacgctttcgccggtcatgatggagatcatccgcaatgagctgggctat
gatggtctggtgatgaccgacgacatctcgatgaaggccctatggcaggacgcggcccaa
gatgaggcgcgcaccgctggcgggccatatcccgacgacgaagtgacctggagtgcccga
ttggcgcgtcagtcccttgatgccggctgtgatgtggcgcttttctgcaattcgtcactg
gcggcacgcgccgaggttgtcgcgtccgctgggcagatgactaaggccgctcaacggcgc
gccgaggcggccctggcctgccgcaagccccctgtcgtgcttgacactgaggccgtggaa
gcggaactatctgccctcatgggcggacaggtttatggctga

DBGET integrated database retrieval system