KEGG   Ruegeria sp. TM1040: TM1040_0939Help
Entry
TM1040_0939       CDS       T00359                                 

Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
sit  Ruegeria sp. TM1040
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TM1040_0939
Enzymes [BR:sit01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     TM1040_0939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
1002122..1003069
Genome map
AA seq 315 aa AA seqDB search
MSEFNQPISGNDLARFSGPGTFMRLPQATSLEGLDVAVLGVPMDIGTSWRSGTRFGPKQI
RAESAMIRPYNMATGAAPFDALNIADIGDLAINTFNLAESLRIIEDSYDAILGSGVLPFA
MGGDHSITLPILRAMARRYGPVAVIHVDAHADVNDEMFGERETHGTVFRRAYEEGLLEAD
KVYQIGLRGTGYGPDDFKEPQSWGFQHFVASELWNRSLHNMGAEIRRDIGGRPVYISYDI
DSLDPAFAPGTGTPEIGGLTTMQALELIRAFKGLNVVGCDLVEVSPPYDPSGNTALVAAN
LIYEMLCILPGRDRA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagttcaatcaacccatcagcggcaatgatctggcgcggttctcggggccgggc
acctttatgcgcctgccgcaggccacctcgctagagggtctggatgtggcggtgctgggt
gtgccgatggatattggcacctcctggcgttccgggacgcggttcgggcccaagcagatc
cgcgccgagagcgcgatgatccgcccgtacaacatggccaccggggctgcgccttttgat
gcgctcaacattgccgatattggcgatctggcgatcaatacgttcaacctcgcggagtcg
ctgcgcatcatcgaagacagctatgacgcgatcctcggttcgggcgtgcttccctttgcg
atggggggcgatcactcgatcaccctgccgatcctcagggcgatggcgcgcaggtatggc
ccggttgcggtgatccatgtggatgcccatgcggacgtcaatgacgagatgtttggcgag
cgcgaaacccacggcaccgtgttccgccgcgcctatgaagaggggcttctggaggcggat
aaagtttatcagattggtctgcgcggtaccggctatggaccggatgatttcaaagagccg
cagagctggggctttcagcattttgtcgcctccgagctctggaaccgatcgctgcacaat
atgggggcggaaatccgtcgcgatattggcgggcgtccggtctatatctcctatgatatc
gacagtcttgatcccgccttcgcgccgggcaccggcacgccggaaattggcgggctgacc
accatgcaggcgctggagctgatccgcgccttcaaggggctcaatgtcgtgggatgtgat
cttgtcgaagtctcgccgccctacgacccttcggggaatacggcgcttgtagcagccaat
ctgatctatgagatgctgtgcatcctgccaggacgggatagggcgtaa

DBGET integrated database retrieval system