KEGG   Ruegeria sp. TM1040: TM1040_1138Help
Entry
TM1040_1138       CDS       T00359                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sit01100  Metabolic pathways
sit01110  Biosynthesis of secondary metabolites
sit01130  Biosynthesis of antibiotics
sit01230  Biosynthesis of amino acids
Module
sit_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TM1040_1138
Enzymes [BR:sit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TM1040_1138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABF63871
JGI: TM10401138
RoseoBase: TM1040_1138
UniProt: Q1GHJ5
Position
complement(1224499..1225308)
Genome map
AA seq 269 aa AA seqDB search
MSETILDKIKAYKLEEVATDKAAKPLADVEAEARAADPVRGFAERLQKATHQGYGLIAEI
KKASPSKGLIREDFDPATLATAYAEGGASCLSVLTDTPSFQGAKDYLVAARAACDLPCLR
KDFMYDTYQVAEARALGADCILIILASVSDAQAAELEACAFEWGMDVLLEVHNEEELDRA
CLLKSPLMGINNRNLKTFETTLDTTRTLSRMVPPDRTIVCESGLFTPEDLADMAQYGARS
FLIGESLMRQEDVTAATRAILANPLTPSL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaccatcctcgacaaaatcaaggcctacaagctcgaagaggtcgccaccgac
aaagccgccaaacctcttgcggatgtcgaagccgaggcccgcgccgcagatcccgtacgc
ggctttgccgagcgtctacaaaaggccacgcatcagggctatggactgattgccgaaatc
aaaaaagcgagcccttccaagggtttgatccgcgaagatttcgaccctgccacgctcgct
acagcctatgccgaagggggcgcgagctgtctttcggtgctgacagatacgccgagtttt
cagggcgcaaaggactatctggtggcggcgcgcgcggcctgcgatctgccctgcctgcgc
aaggatttcatgtacgacacctatcaggtggccgaagcccgcgcgcttggcgccgactgt
atcctgatcatcctcgcctctgtcagcgatgcacaagcggccgagctcgaagcctgcgcc
tttgaatggggcatggacgtgctcttggaggtccacaacgaagaagaactggaccgcgcc
tgcctgttgaaatcgcccctcatgggcatcaacaaccgcaacctcaagacctttgagacc
acgctcgacaccacccgcaccctgtcgcggatggtgccgccggatcgcacgatcgtctgt
gaaagcggcctgttcacgcccgaggatctggccgacatggcccagtatggcgcgcgcagc
ttcctcatcggtgagagcctgatgcgtcaggaggatgtgaccgccgccacccgcgcgatc
cttgcaaacccgctgaccccctcgctctga

DBGET integrated database retrieval system