KEGG   Ruegeria sp. TM1040: TM1040_1138Help
Entry
TM1040_1138       CDS       T00359                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sit  Ruegeria sp. TM1040
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sit01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sit00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(1224499..1225308)
Genome map
AA seq 269 aa AA seqDB search
MSETILDKIKAYKLEEVATDKAAKPLADVEAEARAADPVRGFAERLQKATHQGYGLIAEI
KKASPSKGLIREDFDPATLATAYAEGGASCLSVLTDTPSFQGAKDYLVAARAACDLPCLR
KDFMYDTYQVAEARALGADCILIILASVSDAQAAELEACAFEWGMDVLLEVHNEEELDRA
CLLKSPLMGINNRNLKTFETTLDTTRTLSRMVPPDRTIVCESGLFTPEDLADMAQYGARS
FLIGESLMRQEDVTAATRAILANPLTPSL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaccatcctcgacaaaatcaaggcctacaagctcgaagaggtcgccaccgac
aaagccgccaaacctcttgcggatgtcgaagccgaggcccgcgccgcagatcccgtacgc
ggctttgccgagcgtctacaaaaggccacgcatcagggctatggactgattgccgaaatc
aaaaaagcgagcccttccaagggtttgatccgcgaagatttcgaccctgccacgctcgct
acagcctatgccgaagggggcgcgagctgtctttcggtgctgacagatacgccgagtttt
cagggcgcaaaggactatctggtggcggcgcgcgcggcctgcgatctgccctgcctgcgc
aaggatttcatgtacgacacctatcaggtggccgaagcccgcgcgcttggcgccgactgt
atcctgatcatcctcgcctctgtcagcgatgcacaagcggccgagctcgaagcctgcgcc
tttgaatggggcatggacgtgctcttggaggtccacaacgaagaagaactggaccgcgcc
tgcctgttgaaatcgcccctcatgggcatcaacaaccgcaacctcaagacctttgagacc
acgctcgacaccacccgcaccctgtcgcggatggtgccgccggatcgcacgatcgtctgt
gaaagcggcctgttcacgcccgaggatctggccgacatggcccagtatggcgcgcgcagc
ttcctcatcggtgagagcctgatgcgtcaggaggatgtgaccgccgccacccgcgcgatc
cttgcaaacccgctgaccccctcgctctga

DBGET integrated database retrieval system