KEGG   Ruegeria sp. TM1040: TM1040_1165Help
Entry
TM1040_1165       CDS       T00359                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sit  Ruegeria sp. TM1040
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sit01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sit00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(1254443..1255372)
Genome map
AA seq 309 aa AA seqDB search
MSSRHCILVGAPVDSGKRRTGCLMGPDAYRTAGLAQALESLGHTVEDIGNVTPAPHAPDD
GTGKLHEPNLTRAWTESLSEAAEAAMARGMPIFLGGDHALALGTVHGVANHAATVGRPLF
VLWLDAHSDFHSLESTETGNLHGCPVRYFTNQARFDNFPPVPNPVPPENVCMIGLRSVDT
PEREAMEQVGIHRHDMRDIDENGIARPLSAFLEKVAAQNGMLHVSLDVDFLDPSVAPAVG
TTVPGGATVREGHLVCEILHDSGLMTSMDLVELNPFLDERGRTAHLMVDLCASAMGRRVF
DRPTRSYNT
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctcgtcactgtattctcgttggcgcacccgttgacagcggcaagcgccgcacg
ggctgtctgatgggccctgatgcctaccgtactgccggtctcgcgcaggcgctcgagagc
ctcggccatacggttgaggacatcggcaacgtgacccctgccccgcatgcccccgacgat
ggcaccggcaaactccacgagccaaatttaacgcgagcctggaccgaaagcctgtctgaa
gcggccgaggcggccatggcgcggggcatgcccattttcttgggcggcgatcacgccctt
gccctgggcaccgtgcacggggtcgcaaaccacgccgccaccgtgggacgaccgctgttt
gtcctctggctcgacgcgcatagtgactttcactcgctcgaaagcacggaaacaggcaat
cttcatggctgcccggtgcgctatttcaccaatcaggcccggttcgacaatttcccgccc
gtgcccaacccggtgccgccggaaaacgtctgcatgatcggcctgcggtcggtggatact
cccgaacgcgaagcgatggagcaggtcggcattcatcgccacgacatgcgcgacattgac
gaaaatggcattgcccggccgctgtcggccttccttgaaaaggtcgccgcgcagaacggc
atgctgcatgtgtctctggatgtggatttcctcgacccctccgttgcgcctgccgtgggc
accacggttcccggcggcgccaccgtgcgcgaaggccatctggtctgcgaaatcttgcac
gatagcggcttgatgacctcgatggacttggtggaactcaaccccttcctcgacgagcgt
ggccgtacagcacatctgatggtggatctctgtgcctctgccatggggcggcgcgtcttt
gaccgaccgacccggagctacaacacatga

DBGET integrated database retrieval system