KEGG   Ruegeria sp. TM1040: TM1040_1204Help
Entry
TM1040_1204       CDS       T00359                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sit  Ruegeria sp. TM1040
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sit01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sit00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
1293829..1294935
Genome map
AA seq 368 aa AA seqDB search
MAALSTARRVVIKIGSALLVDRTSSALRQEWLLSLAEDVARLKKQGKDVILVSSGSIALG
RGALGLPRKDLPLEQSQAAAAVGQIRLARAYEEALAPHGITTAQVLVTLEDSENRRRYLN
SRATLETLIGLGAVPIVNENDTIATDEIRYGDNDRLAAQVAVTVGADVLILLSDVDGFYS
ANPALDPDAKRFDRIEQITPEIEAMAGDGVSGLSKGGMITKLLAAKMATAAGCAMAISEG
SVMSPVSALEAGAASTWFTAQGDPQVARKRWIAAMKTRGVITVDEGAAKALHNGNSLLPA
GVRHVEGDFGRGDPLAILGPDGRKLGQGLSRYTAEEARALQGHRSDEIEAILGYAGRAAL
IHRDDMAL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
ttggcagccctaagcacggcgcggcgcgtcgtcatcaagatcggctccgcccttttggtg
gatcgcaccagcagtgccttgcggcaggagtggctcctgtcgctggcagaggatgtggcc
cgcctgaaaaaacagggcaaggatgtgatcctcgtgtcctcgggctcgattgcgctgggg
cgcggtgccctgggcctgccgcgcaaggatctgccgcttgaacagtcacaggccgccgca
gctgtgggccagatccggcttgcgcgcgcttatgaggaggccctggcgccgcatgggatc
accacggcgcaggtgcttgtaacgctggaggacagcgaaaaccgccgccgttacctcaat
tcccgcgccacgctcgagactttgatcggtctgggcgcggtgcccatcgtcaatgagaac
gataccatcgccaccgacgagatccgctatggcgacaacgaccgtctggcggcccaggtc
gcggtgacggtgggggccgatgtgctgatcctgttgtcggatgtggacgggttctacagc
gccaatcctgcgcttgatccagacgccaaacggtttgaccggatcgaacagatcacgccc
gagatcgaggcaatggcgggcgatggggtctcggggctgtccaaaggcggcatgatcacc
aagctcttggcggccaagatggccaccgccgcaggctgcgccatggcaatctccgaagga
tcggtgatgtcgccggtttcggcacttgaggctggggctgcttcgacgtggttcacagcc
caaggtgacccgcaggtcgcgcgcaaacgctggatcgccgcgatgaaaacccgcggcgtg
atcaccgtggatgaaggtgcggccaaggcgctgcacaacggaaacagtctgctgcccgca
ggggtgcgtcatgtggagggtgactttggccgcggagatccgctggccatcctcggccca
gatggccgtaagctggggcaggggctgagccgctacacggccgaggaagcccgcgccctt
cagggacatcgttcggatgagatcgaggcgatcctcggctatgctggacgtgcggccctg
atccaccgggatgacatggcgctttga

DBGET integrated database retrieval system