KEGG   Ruegeria sp. TM1040: TM1040_1305Help
Entry
TM1040_1305       CDS       T00359                                 

Gene name
ybcS
Definition
(GenBank) phage related lysozyme
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
sit  Ruegeria sp. TM1040
Brite
Enzymes [BR:sit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     TM1040_1305 (ybcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysozyme
Motif
Other DBs
NCBI-ProteinID: ABF64038
JGI: TM10401305
RoseoBase: TM1040_1305
UniProt: Q1GH28
Position
complement(1397338..1397748)
Genome map
AA seq 136 aa AA seqDB search
MAKWEGVRLEAYRDIVGVPTICFGDTHGVQIGDTATMAECVDRLEKDVRAFYSEIRPCMT
NPNIPAGVQASMLELAYNVGSGPVCRSTMMRLANAGKHRAACDELRRWVIAGGKRVRGLA
NRRADSKRTLCLKGLT
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagtgggaaggtgtgcggcttgaggcctaccgcgatatcgtgggtgtgccgacg
atctgtttcggcgatactcacggcgttcagatcggtgacactgcgactatggctgaatgc
gtcgaccggctcgagaaagatgtgcgtgcattttattccgagatccgtccttgcatgacg
aacccgaatattccggcaggtgttcaggcctccatgctagagcttgcatacaatgttggg
tctggcccggtttgtcggtcgacgatgatgcgccttgcaaacgctggtaagcaccgggcc
gcgtgcgatgaactgcgccgctgggtgatcgcgggtggcaaacgggtgcgcgggctagcc
aatcgccgggccgatagcaagcgaacgctgtgcctcaaggggctgacctga

DBGET integrated database retrieval system