KEGG   Ruegeria sp. TM1040: TM1040_1305Help
Entry
TM1040_1305       CDS       T00359                                 

Definition
glycoside hydrolase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sit  Ruegeria sp. TM1040
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(1397338..1397748)
Genome map
AA seq 136 aa AA seqDB search
MAKWEGVRLEAYRDIVGVPTICFGDTHGVQIGDTATMAECVDRLEKDVRAFYSEIRPCMT
NPNIPAGVQASMLELAYNVGSGPVCRSTMMRLANAGKHRAACDELRRWVIAGGKRVRGLA
NRRADSKRTLCLKGLT
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagtgggaaggtgtgcggcttgaggcctaccgcgatatcgtgggtgtgccgacg
atctgtttcggcgatactcacggcgttcagatcggtgacactgcgactatggctgaatgc
gtcgaccggctcgagaaagatgtgcgtgcattttattccgagatccgtccttgcatgacg
aacccgaatattccggcaggtgttcaggcctccatgctagagcttgcatacaatgttggg
tctggcccggtttgtcggtcgacgatgatgcgccttgcaaacgctggtaagcaccgggcc
gcgtgcgatgaactgcgccgctgggtgatcgcgggtggcaaacgggtgcgcgggctagcc
aatcgccgggccgatagcaagcgaacgctgtgcctcaaggggctgacctga

DBGET integrated database retrieval system