KEGG   Ruegeria sp. TM1040: TM1040_1351Help
Entry
TM1040_1351       CDS       T00359                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sit  Ruegeria sp. TM1040
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sit00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
1441498..1442535
Genome map
AA seq 345 aa AA seqDB search
MQPMCTGTEYETEMPHISASFPASRPRRLRASAALRDLTRENELSVNDLIWPVFVRDGEG
IEEPVPSMPGVVRRSVDKVVEAAVEAQALGIPAICLFPYTDPSLKTEDCAEAWNPENLCN
RAIRGIKAAAPDLAVMTDVALDPYNINGHDGFVIDGEIRNDETVEALVKMTLAQAEAGAD
IIGPSDMMDGRIGAMRSALERKGFQNVTILSYSAKYASGFYGPFRDAVGASGALTGDKKT
YQMDPANTNEALRMIERDLREGADMVMVKPGLPYLDICHRVKETFQVPTFAYQVSGEYAM
IQAAALNGWIDGEKVMLESLMAFRRAGCDGVLTYFAPQVAKLLNG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccatgtgcaccggaacagaatacgagaccgagatgccccatatcagcgcttcc
tttcctgcctcccgcccccgtcgcctgcgtgcctctgccgctttgcgcgacctcacgcgg
gagaacgaactctcggtgaatgacctgatctggccggtttttgtacgcgatggggagggg
atcgaggagccggttccctcgatgccaggcgtggtgcggcgctctgtcgacaaggtggtt
gaggccgccgtcgaagcgcaggcactcggaattccggcgatctgcctctttccctacacg
gatccgtctttgaaaacagaggattgtgccgaggcttggaacccggagaacctctgcaat
cgggccatccgtgggatcaaggccgcggcgcccgatctcgccgtgatgaccgatgtcgcg
ctagatccctataatatcaacggccacgacggctttgtgattgatggcgaaattcgcaac
gacgaaaccgtcgaggcgctggtcaagatgaccctcgcacaggccgaggccggggcggat
atcatcggcccctctgacatgatggacgggcgcatcggagccatgcggtctgcattggaa
aggaagggatttcagaatgttacgatcctgtcctactctgcaaaatacgcgtctggattt
tatggaccgtttcgtgatgcggtcggcgcctcgggggccctgaccggcgacaagaagacc
tatcagatggaccccgccaacaccaatgaagcccttcgcatgattgaacgcgatctgcgc
gagggggcggatatggtgatggtgaaacccggattgccctatctcgacatctgccaccgc
gtgaaagagaccttccaggtcccgacctttgcctaccaggtgtcaggagaatacgcgatg
atccaagcggcggctctgaatggttggatcgatggggaaaaagttatgctagaaagcctc
atggccttccgtcgggctggatgtgatggtgtgcttacctattttgcgccacaggtcgcg
aaactgttgaacggctaa

DBGET integrated database retrieval system