KEGG   Ruegeria sp. TM1040: TM1040_1489Help
Entry
TM1040_1489       CDS       T00359                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sit  Ruegeria sp. TM1040
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TM1040_1489
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM1040_1489
   00620 Pyruvate metabolism
    TM1040_1489
   00640 Propanoate metabolism
    TM1040_1489
  Energy metabolism
   00680 Methane metabolism
    TM1040_1489
Enzymes [BR:sit01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TM1040_1489
Lipid biosynthesis proteins [BR:sit01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TM1040_1489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
1593933..1595891
Genome map
AA seq 652 aa AA seqDB search
MTTPESAVYPPSEDIVKNAHVNAAKYDEMYAQSLENPEKFWAEQAERIDWIKPFTKVKNV
SYDFGNVDIKWFEDGQLNVAANCIDRHLETRGDQTAIIWEPDDPSDEAKHISYKELHLRT
CRMANILESMGVGKGDRVVIYLPMIPEAAYAMLACARIGAIHSIVFAGFSPDALAARING
CDAKVVITADEAPRGGRKTPLKSNADAALLHCKESVKCLVVRRTGGQTTWIDGRDHDYNE
MALEANDYCKPAAMDAEDPLFILYTSGSTGQPKGVVHTTGGYLTYAALTHEVTFDYHDGD
IYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPTYPDAGRFWAVCEKHKVNQFYTAPT
AIRALMGQGTEFVEKYDLSDLKLLGTVGEPINPEAWNWYNDVVGKSKCPIVDTWWQTETG
GHLMTPLPGAHATKPGAAMKPFFGVEPVVLDPQSGAEIDGNGVEGVLCIKDSWPGQMRTV
WGDHERFEKTYFSDYKGYYFTGDGCRRDADGDYWITGRVDDVINVSGHRMGTAEVESALV
AHAAVAEAAVVGYPHEIKGQGIYCYVTLMNDREPSDELLKELRQWVRTEIGPIASPDVIQ
WAPGLPKTRSGKIMRRILRKIAENDFGSLGDTSTLADPSVVDDLISNRANKG
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcccgagagcgcagtttacccaccgtctgaggacatcgtcaaaaacgcccat
gtcaatgcggcaaaatacgacgagatgtacgcgcaatcccttgagaacccagagaagttc
tgggcagagcaggctgaacgcatcgactggatcaagccgttcaccaaggtcaagaatgtg
tcctatgattttggcaacgtggacatcaaatggttcgaggacggtcagctgaacgtcgca
gccaactgcatcgaccgccatctggagacccgtggcgatcagaccgcgatcatctgggag
cctgatgatccatccgatgaggccaagcacatctcctacaaggagctgcacctcagaacc
tgccgcatggccaacatcctcgagagcatgggtgtcggcaaaggcgaccgagtggtgatc
tacctgcccatgatccccgaagccgcctatgccatgctggcctgcgcgcgcatcggtgcg
atccactcaattgtttttgcagggttttcaccggacgccctggcggcgcggattaatggc
tgcgacgccaaggttgtgatcaccgccgacgaggccccgcgcggagggcgcaagacgcct
ctgaagtcgaacgccgacgccgccctgctgcactgcaaggaaagcgtgaagtgcctcgtg
gtgcgccgcaccggcggtcagaccacatggatcgacggtcgcgaccacgactataacgag
atggcgctggaggcgaatgactactgcaaacccgccgcaatggacgcagaggatccgctg
ttcattctctacacctccggttcgaccgggcagcccaagggcgttgtacacaccaccggt
ggctacctcacctatgccgcactcacccatgaggtgacgtttgattaccacgatggcgac
atctactggtgtacggccgatgtgggctgggtcacgggccatagctatatcgtgtatggc
cccctcgccaatggcgccaccacattgatgtttgagggcgtgcccacctaccccgatgcg
ggccggttctgggcggtctgcgaaaagcacaaggtcaaccagttctacacggcaccgacg
gcgatccgcgccctgatggggcaagggacggaatttgtcgagaaatacgacctctccgac
ctgaagctcctcggcacagtgggcgagcccatcaacccggaggcctggaactggtacaat
gatgtggtcggcaagagcaaatgcccgatcgtcgatacctggtggcagactgagaccggc
ggacacctgatgaccccgctgcctggcgcccacgccaccaaaccgggtgctgcgatgaag
cccttctttggcgtggagcctgtcgtcctcgatccgcagtcgggcgctgaaatcgacggc
aacggcgttgagggcgtgctctgtatcaaggacagctggccgggccagatgcgtacagtc
tggggcgatcacgaacgtttcgagaagacctacttctctgattacaaaggctattatttc
acgggtgatgggtgccgccgcgatgccgacggcgactattggatcaccgggcgcgtggac
gatgtgatcaacgtctctggtcaccgcatgggcaccgccgaggtggaaagcgcgcttgtc
gcacatgccgccgtggccgaagccgctgttgtgggctacccgcatgagatcaagggccag
ggcatctactgctatgtcaccctgatgaatgatcgcgagccttctgacgagctcctgaag
gagctgcgtcagtgggtgcgcaccgagattggccccattgcatcgcctgatgtaatccaa
tgggcgcctggcctgccgaagacacgttcgggcaagatcatgcgccgcatcctgcgtaaa
attgcggagaatgattttggcagcctcggcgacacctcgaccctcgcggatccttcggtc
gtcgatgatctgatctccaaccgtgccaacaagggttaa

DBGET integrated database retrieval system