KEGG   Ruegeria sp. TM1040: TM1040_1562Help
Entry
TM1040_1562       CDS       T00359                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00071  Fatty acid degradation
sit00280  Valine, leucine and isoleucine degradation
sit00281  Geraniol degradation
sit00310  Lysine degradation
sit00362  Benzoate degradation
sit00380  Tryptophan metabolism
sit00410  beta-Alanine metabolism
sit00640  Propanoate metabolism
sit00650  Butanoate metabolism
sit00903  Limonene and pinene degradation
sit00930  Caprolactam degradation
sit01040  Biosynthesis of unsaturated fatty acids
sit01100  Metabolic pathways
sit01110  Biosynthesis of secondary metabolites
sit01120  Microbial metabolism in diverse environments
sit01130  Biosynthesis of antibiotics
sit01200  Carbon metabolism
sit01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TM1040_1562
   00650 Butanoate metabolism
    TM1040_1562
  Lipid metabolism
   00071 Fatty acid degradation
    TM1040_1562
   01040 Biosynthesis of unsaturated fatty acids
    TM1040_1562
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TM1040_1562
   00310 Lysine degradation
    TM1040_1562
   00380 Tryptophan metabolism
    TM1040_1562
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TM1040_1562
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TM1040_1562
   00281 Geraniol degradation
    TM1040_1562
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TM1040_1562
   00930 Caprolactam degradation
    TM1040_1562
Enzymes [BR:sit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     TM1040_1562
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TM1040_1562
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     TM1040_1562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 F420_oxidored 2-Hacid_dh_C UDPG_MGDP_dh_N DAO NAD_Gly3P_dh_N NAD_binding_8 Pyr_redox_2 FAD_binding_3 ApbA Sacchrp_dh_NADP AlaDh_PNT_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ABF64295
JGI: TM10401562
RoseoBase: TM1040_1562
UniProt: Q1GGC1
Position
1667347..1669548
Genome map
AA seq 733 aa AA seqDB search
MTDFKYDVDADGIAIITWDAEGKSMNVLTREAFGLVEDYIDRALGDDAVKGVVITSGKKD
FAGGMDLNVLATIREESGENPAQGLFDFTMNGHRILRKLERAGMDAKNNKGGKPIACAIN
GTCAGIGTEIALACHYRTMTDNPKAKIGLPEILLGIFPGGGGTIRYSRMVGAVNAAPVLL
EGKMMDPKKAKSASLVDEVAADPLEAARQWVLNAKDADIVKPWDQKGYKMPGGAPYHPAG
FMNFVGASAMVHGKTQGAFPAAKALLSAVYEGALVDFDTALRIEARWFTHVLMNPSSSAM
IRSLFLNKQALEKGAVRPKGIEDQSVKKIGVLGAGMMGAGIALVSAQAGMEVVLIDRDQD
AADKGKAYSATYMDKGIKRGKATPEKKEALLAQITATADLDALKGCDLIIEAVFEDPGVK
AEMTKKVEAIIPEDCIFASNTSTLPITSLAEASVRPEQFIGIHFFSPVEKMFLVEIIKGE
KTGDRAVAKALDYVRQIRKTPIVVNDARFFYCNRCIIPYINEGARMITEGVSPVLIDNAA
RQLGFPVGPIQLTDETSIDLGAKIARATKAAMGDAYPESPADDLIFWMEDQGRLGRKANA
GFFDYDDKGKRVEYWKGLAEKYPLAEVQPDLVEVQERLMFAQVLEAVRALEENVLMDIRE
GDVGAVLAWGFAPWSGGPLSWLDIIGTPYAAERCDQLAEAYGDRFACPPLLREMAEKGQT
FYGRFAPEEDQAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcaaatacgacgtagacgccgatggcatcgccatcatcacatgggacgcg
gaaggcaagagcatgaacgtcctcacccgcgaggcctttggcctggtggaggactatatc
gaccgtgcgcttggcgatgacgccgtcaaaggcgtggtgatcacttccggcaagaaagac
tttgcgggcggcatggacctgaatgtgttggccaccatccgcgaggaatccggtgaaaac
ccggctcagggcctgtttgattttacgatgaatggccaccgcatcctgcgcaagctggag
cgcgcagggatggacgccaagaacaacaagggcggcaagccgattgcctgcgccatcaat
ggcacctgtgcaggcatcggcaccgagatcgcgctggcctgtcattaccgaaccatgacc
gacaacccaaaggccaagatcggcctgccggagatcctgctgggcatcttccccggtggc
ggcggtaccatccgctattcgcgcatggtgggtgccgtgaacgccgcccccgtgctgctt
gaaggcaagatgatggaccccaagaaggcgaaatccgcgagccttgtggatgaggttgcc
gccgatccgctggaagcggcgcgtcagtgggtgctcaacgccaaagacgccgatatcgtg
aagccctgggatcagaagggctacaaaatgcccggtggtgcgccctatcacccggcgggg
ttcatgaactttgtcggcgcgtctgccatggtgcatggcaagacccaaggcgccttcccg
gcggccaaggcgctgctctcggcggtctatgagggcgcattggtggattttgacaccgcg
ctgcgcatcgaggcgcgctggttcacccatgttctgatgaacccgtcgtcctctgcgatg
atccgctcgctgttcctcaacaagcaagcgctggagaaaggcgccgtgcggcccaagggc
attgaggatcagtccgtgaagaagatcggcgtgctcggcgcaggcatgatgggcgcaggc
attgcactggtttcagcgcaggcgggcatggaggtcgtactgatcgaccgcgatcaggac
gccgccgacaaaggcaaggcctactctgccacctatatggacaagggcatcaagcgcggc
aaagccacgccggagaaaaaagaggcgctgctggcgcagatcaccgcaacagcagatctc
gacgccctcaaaggctgcgatctcatcattgaggcggtgtttgaagacccgggcgtcaag
gccgagatgaccaagaaggtcgaggcgatcatccccgaggattgcatctttgcctccaac
acctcgaccctgccgatcaccagcctggccgaggcctcggtccggcccgagcagttcatc
ggcattcacttcttctctccggttgagaagatgttcctggtggagatcatcaagggtgag
aaaaccggcgatcgcgcggtggccaaggcgctggactatgtacgccagatccgcaagacg
ccgatcgtggtcaatgatgcgcgcttcttctactgcaaccgctgcatcatcccctacatc
aacgagggcgcaaggatgatcaccgaaggtgtctcgccggtgctgatcgacaacgccgcg
cgccagcttggcttcccggtggggccgatccagctgacggatgagacctcgatcgatctc
ggtgcaaagatcgcacgcgccaccaaggcggcgatgggcgacgcctatcccgaaagcccg
gcggacgatctgatcttctggatggaagatcaggggcgtctggggcgcaaggccaatgcg
ggcttctttgactatgacgacaagggcaagcgcgttgagtactggaaggggcttgcggag
aaatacccgctggcggaggttcagcccgatctggttgaggtccaggagcggctgatgttt
gcgcaggtccttgaggctgtgcgggcactggaggaaaacgtgctgatggacatccgcgag
ggtgacgtgggcgcggttctcgcctggggctttgcgccgtggtccggtggaccgctcagc
tggcttgacatcatcggcacgccctatgcagccgagcgttgtgaccaactggccgaggca
tacggcgaccgttttgcctgcccgccgctcctgcgggagatggccgaaaaaggccagacc
ttctatggccggtttgcgccggaagaggatcaagccgcctaa

DBGET integrated database retrieval system