KEGG   Ruegeria sp. TM1040: TM1040_1571Help
Entry
TM1040_1571       CDS       T00359                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sit  Ruegeria sp. TM1040
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TM1040_1571 (deoA)
Enzymes [BR:sit01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     TM1040_1571 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(1678773..1680077)
Genome map
AA seq 434 aa AA seqDB search
MDARAVIARLRQKHTPSTEELRWFAEGLASGAVSDAQAGAFAMAICLNGLPAAARSDLTL
AMRDSGDVLTWDLPGPVVDKHSTGGVGDCVSLLLAPALAECGAYVPMISGRGLGHTGGTL
DKLEAIPGLSTEVTQDRLAGIVADVGCAIVGATARIAPADKRLYAVRDVTATVESLDLIT
ASILSKKLAASPEALVLDVKIGSGAFMKTVEEARALATSLVETSKAAGCPTQALITDMNQ
PLVPALGNALEVAEVVRALTGQSSGQIIEITVALGGALLQQAGLAPNQEAGETQIAAAIA
EGRAAERFARMIAAQGGPSTELETWARALPQAPVCAEVTAEDAGYVAAIDGEALGLLVVR
LGGGRMVESDRIDPAVGISDLLHLGAKVARGDVIARVHAAHAEAAQDAISALRAAVRLAP
AAPDLPPLLHERIS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgcgcgcggtcattgcccggttaaggcagaaacacaccccaagcaccgaggag
ctgcgctggtttgccgaggggcttgccagtggcgccgtcagcgacgcgcaggcgggcgcc
tttgctatggcgatctgtctcaacgggttgccagccgcggcgcgctctgacctgacactt
gcgatgcgcgacagcggcgatgttctgacgtgggatctgccggggccggtggtggacaaa
cactcgaccggtggggtcggcgattgcgtgtcgcttcttctggcgcctgcgcttgcggaa
tgtggcgcttatgtcccgatgatctcgggacgcggtcttgggcacaccggtggcacgctc
gacaagctggaggcgatccccggtctaagcaccgaggtcacgcaagatcggctggcggga
attgtggccgacgttggctgcgccatcgtgggggcaaccgcgcggattgccccggcggac
aagcggctttatgcggtgcgcgatgtgacggccacggtggagagcctcgatctgattaca
gcatcgatcctttcgaaaaagctggctgccagccccgaggcattggtgctggatgtcaaa
atcggctcgggcgcctttatgaaaactgtggaggaggcgcgcgctttggcgacctctctg
gtggaaacctcaaaggcggcggggtgtccgacgcaggcgctgatcaccgacatgaaccag
ccgcttgttccagccttgggcaatgcgcttgaggttgccgaagtggtgcgggcgctcacc
ggtcagtcgagcgggcagatcatcgagatcaccgtggcacttggtggcgcgctgttgcag
caggcgggacttgcccccaaccaagaggcgggcgagacgcaaattgccgccgcaatcgcc
gaaggtcgcgcggcagagcggtttgcccgaatgattgccgcgcagggtggtccgtccaca
gagcttgagacatgggcgcgcgcgctgccgcaagcaccggtctgcgcagaggtcacggcc
gaggacgcaggctatgttgcggcgatcgacggcgaggcccttggtctgctggtggttcgg
ctgggcggcgggcgtatggttgaaagcgaccgtatcgaccctgcggtcgggatctcggac
ctgctgcacttgggggccaaagtggccaggggcgatgtcattgcgcgcgttcatgccgcc
cacgcagaggccgcgcaagatgcgatctcggccttgcgggcggcggtgaggcttgcacct
gccgcacccgacctgccgccgctgttgcatgagaggatcagctga

DBGET integrated database retrieval system