KEGG   Ruegeria sp. TM1040: TM1040_1728Help
Entry
TM1040_1728       CDS       T00359                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sit  Ruegeria sp. TM1040
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sit00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sit00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(1824709..1825200)
Genome map
AA seq 163 aa AA seqDB search
MITLIVARARNGAIGKDNDIPWHAPEDLKAFQRETLGGAIIMGRNTWDSLPFKPLKNRFN
IVVSSNPDAADTVVASLDEAIDLARSEGYARLYGIGGAGIYKGMLARADRLMITEVDLEI
DDADAFFPEFPPEEWRVNATLPLRAEDPACVLTEYLRLPRAQG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgcttatcgtcgcgcgggcgcgaaacggtgccattggcaaagacaacgacatc
ccttggcacgcgcccgaggatctgaaggcgtttcagcgggaaacgctgggaggtgcgatc
atcatgggccgcaacacctgggacagtttgccattcaagccattgaaaaacaggttcaat
atcgtcgtgtcctcaaacccggatgcggcggacaccgtggtggccagtcttgatgaggca
atcgatctggcccgaagcgaaggctacgcccgcctctatggtatcggcggggccgggatc
tacaagggcatgctggcacgagctgatcgcttgatgattaccgaagtggaccttgaaata
gatgatgccgacgcgtttttcccggagtttcctccggaggagtggcgtgtcaacgcgacg
ctgcctcttcgtgcagaggacccggcctgtgtcttgaccgaatatctgagattgcctcgc
gcacagggataa

DBGET integrated database retrieval system