KEGG   Ruegeria sp. TM1040: TM1040_1728Help
Entry
TM1040_1728       CDS       T00359                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sit  Ruegeria sp. TM1040
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TM1040_1728
   00670 One carbon pool by folate
    TM1040_1728
Enzymes [BR:sit01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     TM1040_1728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(1824709..1825200)
Genome map
AA seq 163 aa AA seqDB search
MITLIVARARNGAIGKDNDIPWHAPEDLKAFQRETLGGAIIMGRNTWDSLPFKPLKNRFN
IVVSSNPDAADTVVASLDEAIDLARSEGYARLYGIGGAGIYKGMLARADRLMITEVDLEI
DDADAFFPEFPPEEWRVNATLPLRAEDPACVLTEYLRLPRAQG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgcttatcgtcgcgcgggcgcgaaacggtgccattggcaaagacaacgacatc
ccttggcacgcgcccgaggatctgaaggcgtttcagcgggaaacgctgggaggtgcgatc
atcatgggccgcaacacctgggacagtttgccattcaagccattgaaaaacaggttcaat
atcgtcgtgtcctcaaacccggatgcggcggacaccgtggtggccagtcttgatgaggca
atcgatctggcccgaagcgaaggctacgcccgcctctatggtatcggcggggccgggatc
tacaagggcatgctggcacgagctgatcgcttgatgattaccgaagtggaccttgaaata
gatgatgccgacgcgtttttcccggagtttcctccggaggagtggcgtgtcaacgcgacg
ctgcctcttcgtgcagaggacccggcctgtgtcttgaccgaatatctgagattgcctcgc
gcacagggataa

DBGET integrated database retrieval system