KEGG   Ruegeria sp. TM1040: TM1040_1792Help
Entry
TM1040_1792       CDS       T00359                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sit  Ruegeria sp. TM1040
Brite
Enzymes [BR:sit01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TM1040_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
1885491..1886138
Genome map
AA seq 215 aa AA seqDB search
MSGPDAQTKMQFLFALRSRGVTEAAVLEAMEAVDRGLFLRGIFSERAYEDVPLPIACGQT
ISQPSVVGLMTQALQVNPRDTVLEVGTGSGYQAAILAKLARRVYTVDRHGRLVREARQVF
QQMSLSNITSLVGDGSHGMPDQAPFDRIIVTAAAEDPPGPLLAQLKVGGIMVVPVGQSDA
VQTLIRVRKTENGLEYDELRPVRFVPLLEGLGKDT
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggcctgacgcgcaaaccaagatgcagtttctctttgccctgcgctcgcgcggg
gtcaccgaagctgccgttctggaagccatggaggccgtggatcgcggcctgttcctgcgc
ggcattttttcggaacgcgcctatgaggatgtgccgctgccgattgcctgtggtcagacg
atttcgcagccctccgttgtgggcctgatgactcaggcgctgcaggtcaatccccgcgac
accgtgctcgaggtggggaccggctcgggctatcaggcggcgatcctcgccaagctggcg
cgccgagtctatactgtcgaccgccacggacgccttgtgcgcgaggctcggcaggtgttc
cagcaaatgagcctgtccaatatcacatccctggtgggcgatggcagccatggcatgccg
gatcaggcgccgtttgatcgaatcatcgtcaccgccgctgccgaagatccccccggcccg
ctcttggcgcagttgaaggtcggcggcatcatggtggtcccggtgggccaatcggatgcg
gtccagaccctgatccgcgtccgaaagaccgaaaatgggctggaatatgacgaattgcgc
cccgtgcgctttgttcctctgctggaagggcttggaaaagacacctga

DBGET integrated database retrieval system