KEGG   Ruegeria sp. TM1040: TM1040_1816Help
Entry
TM1040_1816       CDS       T00359                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
sit  Ruegeria sp. TM1040
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    TM1040_1816
  Amino acid metabolism
   00380 Tryptophan metabolism
    TM1040_1816
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    TM1040_1816
Enzymes [BR:sit01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     TM1040_1816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
1909253..1910500
Genome map
AA seq 415 aa AA seqDB search
MRHITKPPLPRPETSAKTDFMKTLTQSPTDPDFVQNPYPFYDAARAAGKLGYWEEYKMMA
AFGHDVVHMLLRDRRFGREIPAEMATEGPAHLAPFLQVEAHSLLDAEPPRHTRLRKLVLR
AFTSREIKALAPGLETLCHELINAFPKDAPFDLLSSYCTQVPVIAICRLLGVPEAMAPQL
LDWSHKMVAMYQASKTTETEHAAAQASAEFIAFLTDYVDERRKTPGEDLITRLIQAEEDG
ESLSTDELIGTCILLLNAGHEATVHSLGNGVKTMLEQGWSSEWLQPDGISGLVEEILRYD
PPLHMFTRYAYEEIEIMGHRFRRGDQVALMLAAANRDPEALERADQFDPTRPPKVNKSFG
GGLHFCVGAPLARMEMEIALPILFERCPELKLAEPPQYSNTYHFHGLTRLWVQTR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccacattacaaagccccccttgccaagaccagagacctcggcaaaaaccgatttt
atgaaaacactgacccaatccccgaccgacccggactttgtccagaacccctacccgttt
tacgacgcggcccgcgcggccggcaaacttgggtattgggaagagtacaaaatgatggcg
gcctttggtcatgacgtggtgcacatgctgctgcgcgaccgccgctttgggcgcgaaatc
cccgccgagatggccaccgaaggcccggcgcatctggcgcccttcctgcaagtagaggca
cattcgcttctggatgcggaaccgccccgccatacgcggctgcgcaaactggtgctgcgc
gccttcaccagccgcgagataaaggcgcttgcgccggggctagagacgctctgccacgaa
ttgatcaatgcgttccccaaggatgcgccctttgatctgctcagcagctattgcacgcag
gtgccggtgatcgcgatctgtcgcctgctgggcgtacccgaggccatggcgccgcaactt
ctcgactggtcgcacaagatggtggcgatgtatcaggcctccaagaccaccgagaccgaa
catgccgcagcacaggccagcgccgagttcatcgcctttttgaccgactacgtagacgag
cgccgcaagaccccgggcgaggatctcatcacccggctcattcaggccgaggaagatggc
gaaagcctctcgacggacgagctcatcggcacctgcatcctgctcctaaatgctggtcac
gaggccacggtgcattcgctcggcaacggggtgaaaaccatgctcgaacagggctggtct
tccgagtggcttcagcccgatggcatcagcgggctcgtcgaggaaatcctgcgctatgac
ccaccgctccatatgttcacacgctacgcctatgaggagatcgagatcatgggccaccgt
ttccggcggggcgatcaggtggctctgatgctggcggctgccaaccgagatccggaggcg
ctggagcgcgccgatcagtttgatcccacgcgcccgcccaaggtgaacaagagctttggc
ggcgggctgcatttctgtgtcggcgcaccgcttgcgcggatggagatggagatcgcgctg
ccgatcctttttgagcgctgcccggagttgaaactggccgagccgccccagtattccaac
acctaccatttccatgggctgacccggctttgggtgcaaacccgctaa

DBGET integrated database retrieval system