KEGG   Ruegeria sp. TM1040: TM1040_2269Help
Entry
TM1040_2269       CDS       T00359                                 

Definition
lipolytic protein G-D-S-L
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sit  Ruegeria sp. TM1040
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    TM1040_2269
Enzymes [BR:sit01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TM1040_2269
   3.1.2  Thioester hydrolases
    3.1.2.-  
     TM1040_2269
Lipid biosynthesis proteins [BR:sit01004]
 Fatty acid synthase
  Component type
   TM1040_2269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(2383855..2384532)
Genome map
AA seq 225 aa AA seqDB search
MRKFLKQIVVSLVSIPLLLGVAQAEPVRITAFGDSLVQGYGLPQGEGLVAQLRDWFAVEG
FDVALTNAGVSGDTTAGGAARIDWTLAETPDAMIVLLGGNDLLRGLPPEDTRANLSRIIE
AARGAGAEVLLIGMQAPGNYGADYKAAFDSIYPDLTATHDLVLHPFAFAGMAAEAGEDPA
QMGAYMQADGIHPNARGVALNIKAMEPALHALMARLSQPEDSANN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagtttctaaagcaaattgtggtcagtttggtgagcattccattgctcctgggc
gtggcgcaggcggagcccgtgcggatcaccgcttttggcgatagcttggtgcagggctat
gggctgccccagggcgagggtctggtggcgcagctgcgggactggttcgcggtggagggc
tttgatgtcgcgctgaccaatgcgggggtctctggcgacaccaccgccggcggcgcggcg
cgcatcgattggacccttgcggaaaccccggacgccatgatcgtgctcctgggcggaaat
gacctgctgcgcggacttccccccgaagacacccgcgccaatctcagccggatcattgag
gccgcgcgcggggcaggggccgaagtgctgctcatcgggatgcaggcgccgggcaattat
ggcgccgactacaaggccgcttttgacagtatctatccggatctgaccgcgacgcatgat
cttgtgctgcacccgtttgcctttgccgggatggccgcagaagcaggagaggatccggcc
cagatgggcgcctacatgcaggcggatggcatccatcccaatgcgcgtggtgtcgccttg
aatatcaaggcgatggagcccgcccttcacgcgctgatggcgcggctttcacaacctgag
gacagcgccaacaactag

DBGET integrated database retrieval system