KEGG   Ruegeria sp. TM1040: TM1040_2330Help
Entry
TM1040_2330       CDS       T00359                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00260  Glycine, serine and threonine metabolism
sit00750  Vitamin B6 metabolism
sit01100  Metabolic pathways
sit01110  Biosynthesis of secondary metabolites
sit01120  Microbial metabolism in diverse environments
sit01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TM1040_2330
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TM1040_2330
Enzymes [BR:sit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TM1040_2330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABF65062
JGI: TM10402330
RoseoBase: TM1040_2330
UniProt: Q1GE54
Position
complement(2450310..2451701)
Genome map
AA seq 463 aa AA seqDB search
MKYISTRGQAPELTFEEAMLTGLARDGGLYVPAEIPTLSAEEIAGFAGLPYEEVAFRVMW
PYVSGSFSEEEFKGIIARAYAGFEHAARAPLKQMAPNHFLLELFHGPTLAFKDFAMQLIG
QLFQVALKRRGDSVTIVGATSGDTGSAAIEAFRGLDAVNVFIMYPHGRVSEVQRRQMTTP
QDANVHALAVDGDFDDCQAAVKDMFNDFDFRDSVHLAGVNSINFARVLAQVVYYFTAAVA
LGAPHRKVSFTVPTGNFGDIFAGFIARQMGLPIDQLVVATNQNDILHRCLSGEGYFKGET
IPSISPSMDIQVSSNFERALFYAYDQDGAAVAQLMDELKTGGGFNVSQGAMQALSEIYSS
GRASEEETSATIKSELAASGELLCPHGAVGVKVANEHLKDGVPMVTLATAHPAKFPAAVE
AASEVHPPLPPRMADLYDRSERVTRIANDLGAIEDHIRKHIAN
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatctccacccgcggccaagcgcccgaactcaccttcgaagaagccatgctg
accgggcttgcgcgcgacggcgggctttatgttccggcagaaatcccgacgctctcggca
gaggaaatcgcaggctttgccgggctgccttatgaggaggtcgcgtttcgcgtgatgtgg
ccctatgtgtcggggtctttctccgaagaggaattcaagggcatcatcgcgcgcgcctat
gccgggtttgagcacgccgctcgcgcgccgctgaaacagatggcgccgaaccacttcctg
ttggagctctttcacggcccgacgttggcgttcaaggatttcgccatgcagctcatcggt
cagctgtttcaggtcgcgctcaaacgccggggcgacagcgtgaccatcgtgggtgccact
tctggcgacaccgggtccgcggcgatcgaggcgtttcgcggtctggacgcggtcaacgtc
tttatcatgtatccccatggccgcgtctccgaggtgcagcgccgccagatgaccacaccg
caggacgccaatgtgcatgccctcgcggtggatggagactttgacgactgccaggctgcg
gtcaaagacatgttcaacgattttgacttccgcgattcggtgcatctggcgggcgtgaac
tcgatcaactttgcccgcgttttggcgcaggtggtctattacttcaccgctgccgtggcc
ttgggcgcaccgcaccgcaaagtgtccttcaccgtgccgaccggtaactttggcgacatc
tttgcgggctttatcgcgcgccagatggggctgccgatcgatcagctggtggtcgccacc
aaccagaacgacatcctgcaccgctgcctctcgggcgagggctatttcaaaggcgagacc
atcccgtcgatttcgccttctatggatattcaggtctcttcgaacttcgagcgggccttg
ttctatgcctacgatcaggacggcgcggctgtggcgcagctgatggacgaactgaagacc
ggtggtggttttaacgtgagccagggggccatgcaggcgttgagcgaaatctacagctca
ggccgcgcttccgaggaggagacttccgccacgatcaaatccgaactcgcggcctcagga
gagctgctttgcccacatggggcagttggggtgaaggtcgccaatgaacacctcaaggat
ggggtgccgatggtcacgctggccacggcgcatcccgcaaaattcccggccgcggtcgag
gcggcctcggaggtgcatccgcctcttccccctcgcatggcagacctgtatgacagatcg
gagcgcgtgacccggatcgccaatgatctcggcgcgattgaagatcatatcagaaagcac
atcgccaattga

DBGET integrated database retrieval system