KEGG   Ruegeria sp. TM1040: TM1040_2372Help
Entry
TM1040_2372       CDS       T00359                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sit  Ruegeria sp. TM1040
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sit00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TM1040_2372 (ruvA)
Enzymes [BR:sit01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TM1040_2372 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(2492868..2493557)
Genome map
AA seq 229 aa AA seqDB search
MIGKLTGRLDYKTPDHVMIDVRGVGYIVYCSDRTLASLPAVGEAVQLYTELLVREDLMQL
FGFTSLVEKEWHRLLTSVQGVGAKVSLAILSALGPEGVSRAIALGDWAAVKAAKGVGPKT
AQRIVLDLKDKAPSVMAMGGTVTEALEGPELDAVVEPAAEAPAKPARKAAPKAPTGAAAA
SAGALSALGNLGYGPSDAAGAVAEAAANNPDAGEAELIRAALRLLAPKG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaaattgaccgggcgtctggattacaagactccggaccatgtgatgatcgac
gtgcgcggcgtcggttatatcgtctactgctcggatcgcaccttggcgagcctgcctgct
gtaggcgaggcggttcagctttataccgagcttttggtgcgcgaagatctcatgcagctc
tttgggttcacgtccttggtggaaaaggaatggcaccgattgctgacctcggtgcagggg
gtaggggccaaagtgtcgcttgccatcctgagtgcgctggggcccgaaggtgtcagccgt
gcgatcgcccttggcgattgggcggcggtgaaagccgccaaaggggttggccccaagacc
gcgcagcgcatcgtgctcgaccttaaagataaggcaccctccgtgatggcgatggggggc
acggttacagaggcgctagaggggccggaattggacgcagtggtcgaacccgcagctgag
gcgccggcaaagcctgcgcgcaaagccgccccaaaggcccccaccggcgcggcagccgct
tcggcgggggcactgtcggcattgggcaacctgggttacgggccttccgatgccgcaggt
gcggtcgcagaggccgccgccaacaatccagacgcaggcgaagcggaattgatccgtgcc
gcgcttcggctcttggcacccaaagggtga

DBGET integrated database retrieval system