KEGG   Ruegeria sp. TM1040: TM1040_2472Help
Entry
TM1040_2472       CDS       T00359                                 

Definition
thiol peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sit  Ruegeria sp. TM1040
Brite
Enzymes [BR:sit01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     TM1040_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
2612366..2612851
Genome map
AA seq 161 aa AA seqDB search
MISVGDKLPEATLTRLGAEGPEAVAIQDLAKGRKLAIFAVPGAFTPTCHSAHVPSFIRTK
DQFAAKGVDEIICISGNDPFVMKAWGEATGATEAGITMLADAECSFTDAIGMRFDAPPAG
LIGRSKRYAMIVEDGEVKILHLEESPGTCEVSAGEGLLDAL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatatctgttggagacaaactccccgaggccaccttgacccgactgggcgccgaaggc
cccgaagcggttgcgatccaagacctcgccaaggggcgcaagctggccattttcgctgtg
ccgggcgcctttactcccacttgccactctgcgcatgtgccgagtttcattcgtaccaag
gaccagtttgcggccaaaggcgttgacgaaatcatctgtatctcaggcaacgatcccttc
gtcatgaaagcctggggcgaggccaccggggcaaccgaggcgggaatcaccatgctggca
gatgcggagtgcagctttaccgatgcaatcgggatgcgttttgacgcgccaccagccggg
ctcatcgggcgttccaaacgctacgcaatgatcgtcgaggatggtgaggtaaaaatcctg
cacctcgaagaaagtccgggaacatgtgaagtgtctgctggtgaagggctgctggatgcg
ttgtaa

DBGET integrated database retrieval system