KEGG   Ruegeria sp. TM1040: TM1040_2553Help
Entry
TM1040_2553       CDS       T00359                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
sit  Ruegeria sp. TM1040
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    TM1040_2553
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TM1040_2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(2697020..2697520)
Genome map
AA seq 166 aa AA seqDB search
MFDTMTLTKATAGFCGAFLVFLLGKWVAEELYHVEAHGEASYVIEVADAGGASDEPEVDF
ATLMASADVDKGAKVFRKCSACHKLDGTDATGPHLDGVVGRDIAASAGFGYSGALTALEG
AWTPEALNEFLLKPSDYASGTTMSFAGLKKVEDRVNLIAYLQTTAN
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacacaatgacactcaccaaagcgaccgcaggtttctgtggcgcgttccttgtg
ttcctcttgggcaaatgggttgccgaggagctctatcacgttgaggcacacggagaggcg
tcctacgtcatcgaggtggctgatgcaggtggtgcaagcgacgagcctgaggtggacttt
gcgacgctgatggcctcggcggatgtcgacaagggtgctaaagtcttccgcaagtgctcc
gcatgccacaagcttgacggcactgatgcaaccggcccgcacctcgacggtgttgttggc
cgcgatatcgcagccagcgcaggctttggctactccggtgcgctgaccgcgcttgagggc
gcttggacaccagaagcgctgaacgaattcctcctcaagccgtccgactatgcctccggg
accaccatgtcctttgcaggtttgaaaaaggttgaggaccgggtgaacctgatcgcctat
ctgcagaccactgcaaactaa

DBGET integrated database retrieval system