KEGG   Ruegeria sp. TM1040: TM1040_2739Help
Entry
TM1040_2739       CDS       T00359                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00511  Other glycan degradation
sit00520  Amino sugar and nucleotide sugar metabolism
sit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TM1040_2739
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TM1040_2739
Enzymes [BR:sit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TM1040_2739
Chaperones and folding catalysts [BR:sit03110]
 Intramolecular chaperones
  Others
   TM1040_2739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: ABF65471
JGI: TM10402739
RoseoBase: TM1040_2739
UniProt: Q1GCZ5
Position
complement(2883772..2885655)
Genome map
AA seq 627 aa AA seqDB search
MHFHLDSLWHAEEGAMEFALTNCGTTPVTNPRLVYATLTRCLRPSNCTGARLVRRQANFH
EYASDEGFVLAPGETWRFTEHSLTRPALHSNEGPKSAGVLLEDDTLVLAFAGDLQASVVE
GHATAVQNAALTCGILPEPKRVAISNWAETAPVHLALQSDDAAVMQLVSRVSELTRRLHP
LAPTPFVLTAKEDVALLCITPDQTLPADGYRITWDEGKTTLHHGSGRGLFYGLVSLAQML
THAHAEPQRYGVPLSGEIEDAPRHGWRGAHLDVSRQFYPLDQVLRYVDIMAWHKMNRFHW
HLTDDEGWRLEIKAYPQLTETAAHTGMDLPVLPQLGPDMTGQSGFYTQDEARQVVKHAAQ
FGIEVMPEIDVPGHCACVLGALPDLVDPEEPESYWSVQGFANNALNPAIEESYTFAETVL
AEVCEIFPFEVVHVGGDEVAEGAWMQSPKAQAMMRETGLKDTPQLQAYFLRHIQTYLAGL
GRKLGGWEEVAHGGGLDPEHSLLFAWTTIEKTAELAQEGYDVISTPGQAYYLDMALSDAW
YAPGASWAGFTPLDKTYAFEADNGDPVLQGRLKGVQACVWSEHLTTMARRNHMIFPRLSA
IAEAGWSAAENKAYDRFKSLAELMPRL
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgcattttcacctcgatagcctctggcatgccgaagaaggcgcgatggagttcgcgctg
accaattgtggcacaacccccgtgaccaacccgcgcctcgtttacgcaacgctcacgcgg
tgtttgcggccttcgaactgcaccggggcacggcttgtgcggcggcaggcaaactttcac
gaatacgcctcggacgagggattcgtgctcgcaccgggagagacttggcggttcacggag
catagcctcacccgtccggcgcttcattccaatgaggggccaaaatcagcgggagtcctc
ttggaggatgacacgctcgtgctggcatttgccggggacttgcaggcctctgtggtggaa
ggtcacgcaacagctgtgcaaaatgcggctctaacatgcgggattctgcccgaacccaag
cgtgtcgctatctcgaactgggctgagaccgcccctgtgcatctcgcgcttcagagtgat
gacgcagcggtgatgcagttggtatcgcgcgtctctgagctgactcgccgtttgcatccg
cttgcgccgacaccgtttgtgttgaccgccaaggaggacgtggcactgctctgcattacg
ccggatcagacactccccgcagatggctatcgtatcacttgggacgaagggaaaaccacc
ctgcatcacggcagcgggcgggggctgttttacggtctggtgtcgctggcgcagatgctc
acccatgcccacgctgagcctcagcgctatggcgtgccgctcagcggagagatcgaggac
gccccccgccacggttggcgcggtgcgcatctggatgtctcgcgccagttttacccgctc
gatcaggttctgcgctacgtggacatcatggcgtggcacaagatgaaccggttccattgg
cacctgactgacgatgaaggctggcggctggagatcaaagcctatccgcagctcactgag
accgccgcacataccggcatggacctgcccgtcttgccgcagcttggcccagacatgacc
gggcagagcggtttttacacccaggacgaggcccgtcaggtggtgaaacacgccgcgcag
ttcggcatcgaagtaatgccggagatcgacgtgcccggtcactgtgcttgcgttctgggc
gcgttgcctgatctggtcgatcccgaagagcccgagagctactggtcggtgcaggggttt
gccaacaacgcgctcaacccggcgatcgaggagtcttatacctttgccgagaccgttttg
gccgaggtctgcgagatcttcccgtttgaggtcgttcatgtggggggcgatgaggtggcc
gagggcgcttggatgcaatcgcccaaagcgcaggcgatgatgcgcgaaacgggtctaaag
gacacgccgcaattgcaggcttatttcctgcgtcacatccagacctatctggcggggctt
ggtcgcaagcttggcggttgggaagaggtggcccatggcggtggtcttgatcccgagcac
agccttttgtttgcctggaccacaatcgagaaaaccgcggagctggcgcaagaaggctat
gacgtcatcagcacgcctgggcaggcctactaccttgatatggcgctgtcggatgcgtgg
tatgcaccgggcgccagctgggcgggtttcaccccgctcgacaagacttatgcgtttgag
gccgacaatggcgacccagtgcttcaggggcggctcaaaggtgtgcaggcctgcgtctgg
agtgagcatctgaccacaatggcccggcgcaatcacatgatctttccgcgcctcagcgcc
attgcagaggccgggtggagcgcagccgaaaacaaagcctatgaccggttcaagtcgctt
gcagagttgatgccgcgcctctga

DBGET integrated database retrieval system