KEGG   Ruegeria sp. TM1040: TM1040_2828Help
Entry
TM1040_2828       CDS       T00359                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sit  Ruegeria sp. TM1040
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sit00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(2997862..2998599)
Genome map
AA seq 245 aa AA seqDB search
MNRKGLSLLMTRPLSAAQRFVDLLPSEMCRELPIIYSPLMEIAPLQGLIDLGGIDAVIFT
SGEGVRVASAAQPLRLRAYCVGERTASAACEAGWSAQFVGDTADTLVEALLASRPSGKLL
HLHGEYTRGAVAERLSEGGVSCSGQAIYRQALCPLSAEAEAALTAQIPLIVPLFSPRTAA
HFDSLCPEKAHLSLIAMSDAVAEAMPRLQSRVRHVSKFPTAEAMAELVCDVAAALLRVET
KPPED
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaggaagggcctatctctgttgatgacccgcccgctttccgcggcgcagcggttt
gttgatcttctgccatctgagatgtgtcgtgagctgccgattatctattcgccgttgatg
gagatcgcgccgctgcaaggcctcatcgaccttggcggcatcgatgcggtgatcttcacc
tcgggtgagggcgtgcgggtcgcgtcagcggcgcaacctctgcgtctcagggcctattgc
gttggggaacgcactgccagcgccgcgtgcgaggcaggctggtcggcgcaatttgtgggc
gatacggccgacactttggtggaggccctgttggcgtcccggccatctggaaaattgctg
catctgcacggcgagtacacccgtggcgcggttgccgagcgtctcagcgaaggcggtgtg
tcctgcagtgggcaagcgatataccgtcaggctttatgccctctgagtgctgaggcagag
gctgcgctgacggcgcagatccccttgatcgtgccgcttttttcaccgcgcaccgctgcc
cattttgacagcctgtgtccagaaaaggcgcatttgtcattgattgcaatgagtgacgct
gtggcagaggcgatgccgcgcttgcaaagtcgcgtgcgacacgtaagtaagttcccaacg
gccgaggcgatggcggaactggtctgtgatgtcgcagcagccttgcttcgggttgagacc
aagccgcccgaggactag

DBGET integrated database retrieval system