KEGG   Ruegeria sp. TM1040: TM1040_2878Help
Entry
TM1040_2878       CDS       T00359                                 

Definition
PfkB protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sit  Ruegeria sp. TM1040
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TM1040_2878
Enzymes [BR:sit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TM1040_2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
3049119..3049991
Genome map
AA seq 290 aa AA seqDB search
MAIWNLGSINIDMVYSLPHMPQPGETLAATSFDQGLGGKGANMSVAAARAGAHACHIGAI
GPEGKWCVDRLMEYGVDTRHIVQSDTATGHAIIAVDPAGENQIILYPGANRGLGADQIGQ
ALSAANAGDILLMQNETNMQAEAAEMGRKLGLRVAYAAAPFDAAAVQAVLPFVDLLFLNE
VEAAQLQDATGKPPQDLGVDDVIVTLGAEGARHFDGRTGAVSDVAAQKVTAVDTTGAGDT
FTGYVLAALDRGLPMAQAMAQASRAGALMVTRHGAADVIPDLKEVQDAKF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctggaaccttgggtcgatcaacatcgacatggtctattcgctgccgcatatg
ccgcagccgggcgagacgctggcagccacttcctttgatcagggtctgggcggcaagggc
gcaaatatgtcggttgccgccgcccgcgctggggcgcatgcctgccatatcggggccatt
ggtccagaggggaaatggtgtgtggatcggttgatggagtacggtgtcgatacgcgccat
atcgtgcaaagcgataccgcgaccggtcatgccatcatcgctgtggatccggccggtgaa
aatcagatcatcctctatcccggtgctaaccgtgggcttggtgccgatcagatcggccaa
gcactcagcgcggcaaacgcaggggatattctgctgatgcagaatgagaccaacatgcag
gccgaggccgcagagatggggcgcaaactggggctgcgcgtcgcatatgcggcggcgcct
tttgatgcggcagcggttcaggcggttttgccctttgtggatctcttgtttctcaacgag
gtcgaggcggcacagcttcaggacgccacaggaaaaccacctcaggatctgggtgtcgac
gatgtgatcgtgacactcggggctgaaggcgcgcgccattttgacggtcgcaccggcgct
gtgagcgatgtggctgcgcagaaggtgactgcagtggataccaccggggcgggggacaca
ttcaccggatatgttctggctgcgctggatcgcggattaccgatggcgcaggccatggcg
caggcctcgcgggccggagccttgatggttacacgtcacggagcggcagatgttatcccg
gacctcaaagaggttcaggacgccaaattctga

DBGET integrated database retrieval system