KEGG   Ruegeria sp. TM1040: TM1040_2878Help
Entry
TM1040_2878       CDS       T00359                                 

Definition
(GenBank) PfkB
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TM1040_2878
Enzymes [BR:sit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TM1040_2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Beta-prism_lec
Motif
Other DBs
NCBI-ProteinID: ABF65610
JGI: TM10402878
RoseoBase: TM1040_2878
UniProt: Q1GCK6
Position
3049119..3049991
Genome map
AA seq 290 aa AA seqDB search
MAIWNLGSINIDMVYSLPHMPQPGETLAATSFDQGLGGKGANMSVAAARAGAHACHIGAI
GPEGKWCVDRLMEYGVDTRHIVQSDTATGHAIIAVDPAGENQIILYPGANRGLGADQIGQ
ALSAANAGDILLMQNETNMQAEAAEMGRKLGLRVAYAAAPFDAAAVQAVLPFVDLLFLNE
VEAAQLQDATGKPPQDLGVDDVIVTLGAEGARHFDGRTGAVSDVAAQKVTAVDTTGAGDT
FTGYVLAALDRGLPMAQAMAQASRAGALMVTRHGAADVIPDLKEVQDAKF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctggaaccttgggtcgatcaacatcgacatggtctattcgctgccgcatatg
ccgcagccgggcgagacgctggcagccacttcctttgatcagggtctgggcggcaagggc
gcaaatatgtcggttgccgccgcccgcgctggggcgcatgcctgccatatcggggccatt
ggtccagaggggaaatggtgtgtggatcggttgatggagtacggtgtcgatacgcgccat
atcgtgcaaagcgataccgcgaccggtcatgccatcatcgctgtggatccggccggtgaa
aatcagatcatcctctatcccggtgctaaccgtgggcttggtgccgatcagatcggccaa
gcactcagcgcggcaaacgcaggggatattctgctgatgcagaatgagaccaacatgcag
gccgaggccgcagagatggggcgcaaactggggctgcgcgtcgcatatgcggcggcgcct
tttgatgcggcagcggttcaggcggttttgccctttgtggatctcttgtttctcaacgag
gtcgaggcggcacagcttcaggacgccacaggaaaaccacctcaggatctgggtgtcgac
gatgtgatcgtgacactcggggctgaaggcgcgcgccattttgacggtcgcaccggcgct
gtgagcgatgtggctgcgcagaaggtgactgcagtggataccaccggggcgggggacaca
ttcaccggatatgttctggctgcgctggatcgcggattaccgatggcgcaggccatggcg
caggcctcgcgggccggagccttgatggttacacgtcacggagcggcagatgttatcccg
gacctcaaagaggttcaggacgccaaattctga

DBGET integrated database retrieval system