KEGG   Ruegeria sp. TM1040: TM1040_2996Help
Entry
TM1040_2996       CDS       T00359                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00300  Lysine biosynthesis
sit01100  Metabolic pathways
sit01120  Microbial metabolism in diverse environments
sit01230  Biosynthesis of amino acids
Module
sit_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TM1040_2996
Enzymes [BR:sit01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TM1040_2996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABF65728
JGI: TM10402996
RoseoBase: TM1040_2996
UniProt: Q1GC88
Position
complement(3163282..3164427)
Genome map
AA seq 381 aa AA seqDB search
MTTTDPVQLTADLVRCPSVTPTEGGALVLLERLLTDAGFSCTRVDRGEVCNLFARWGDKA
HARTFGFNGHTDVVPIGDEAAWTHDPFGAEIVEGVMYGRGTTDMKSGVAAFAAAAIDFVQ
DTPPDGAVVLTITGDEEGDAVDGTTALLDYMDAAGEKMSVCLVGEPTCPNHMGEMIKIGR
RGSMTAWFTVTGVQGHSAYPHRANNPMNGLARLMDRLGSHQLDEGSEHFDASTLAIVTID
TGNPATNVIPAQGRAAVNIRFNDLHSGASLTDWLQGEADKVAKEFGLEVDMKVQISGESF
ITPPGDLSDLVSRAVQTETNQAPELSTTGGTSDARFVKSHCPVVEFGLVGKTMHQVDENV
DVAHIHQLKSIYSRILKDYFS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaacagaccccgttcagctcaccgcagatcttgtgcgttgtccttcggtcacg
ccaaccgagggtggtgcgctggtccttttggagcgccttctgacggacgcgggttttagc
tgcacacgggttgaccggggtgaggtctgcaatctctttgcccgctggggcgacaaggcg
catgcgcgtacctttgggttcaatggccacactgacgtggtgcccatcggggacgaagcg
gcctggactcacgatccctttggcgccgagattgtcgaaggcgtcatgtatggccgtggg
acaaccgacatgaagtccggtgttgctgcctttgcggcggcagccatagactttgttcag
gacacaccacccgatggcgcagtggtgctgaccatcacaggtgatgaggaaggcgacgct
gtggatggaaccacggcattgctggactacatggacgcagcgggcgagaagatgtccgtt
tgcctcgtgggagagcccacgtgccccaatcatatgggtgagatgatcaagatcggtcgt
cgcggctcgatgaccgcgtggttcactgtgaccggcgtgcagggacattcggcctatccg
caccgtgcgaacaacccgatgaacgggctcgcgcgcctgatggaccgactcggcagccat
caactggatgagggctcagagcacttcgacgcctctacactggcaattgtcaccatcgac
accggcaacccggcaaccaatgtgatcccggcgcagggccgtgccgcggtgaacatccgc
ttcaatgatctgcactcgggggcgtcgcttacagattggctgcaaggcgaagcagacaaa
gtggccaaagagtttggtcttgaggtcgatatgaaggttcagatctcgggtgaaagtttc
atcaccccgccgggcgatctgtcggatctggtctctcgggccgtgcagaccgaaaccaac
caagcaccggaactctccaccaccgggggcacctcagacgcgcgatttgtgaagtcccat
tgtccggttgtggaatttggcctcgtcggcaagaccatgcaccaggtggatgagaacgtg
gatgtggcccatatccaccaactgaaatccatctactcccgcatcctgaaggactatttt
tcatga

DBGET integrated database retrieval system