KEGG   Ruegeria sp. TM1040: TM1040_3007Help
Entry
TM1040_3007       CDS       T00359                                 

Definition
urocanate hydratase
Orthology
K01712  
urocanate hydratase [EC:4.2.1.49]
Organism
sit  Ruegeria sp. TM1040
Pathway
Histidine metabolism
Metabolic pathways
Module
Histidine degradation, histidine => N-formiminoglutamate => glutamate
Class
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sit00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
3175510..3177198
Genome map
AA seq 562 aa AA seqDB search
MSDPRKNTRDIFPATGTEITAKSWLTEAPMRMLMNNLHPDVAENPHELVVYGGIGRAART
WQDFDLIVETLKTLEEDQTLMVQSGKPVGVFQTHKDAPRVLIANSNLVPHWANWDHFNEL
DKKGLMMYGQMTAGSWIYIGTQGIVQGTYETFAEAGRQHYGGDLTGKWILTGGLGGMGGA
QPLAAVFAGACCLAVECNPDSIDFRLRTKYLDEKAETLDEALEMIERWTKAGEAKSVGLL
GNAADVFAELVERAKAGGMRPDIVTDQTSAHDPVNGYLPQGWTMAEWREKRETDKKAVEK
ASRASMKAHVKAMVDFHEMGIPTVDYGNNIRQVALEEGLETAFSFPGFVPAYIRPLFCKG
IGPFRWCALSGDPEDIRKTDAKMKELFPENESLHRWLDMAQDRIAFQGLPARICWIGLGD
RHKAGLAFNEMVRNGELSAPVVIGRDHLDSGSVASPNRETEAMMDGSDAVSDWPLLNALL
NTASGATWVSLHHGGGVGMGFSQHSGVVICCDGTEDADRRIGRVLWNDPATGVMRHADAG
YEIAKDCAKEHGLNLPGILRSE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccccgcaagaatacccgtgacattttccctgccactggcaccgagatcact
gcgaagtcctggttgacggaggctccgatgcggatgctgatgaacaacctgcaccccgat
gtggctgaaaacccgcatgagctcgtggtttatggcgggattggccgggcggcacgcacg
tggcaggatttcgacctcatcgtcgagaccctcaagactcttgaagaagatcagaccctg
atggtgcagtccggcaaacccgtcggcgtctttcagacccacaaggacgcgccgcgcgtg
ttgatcgccaactccaacctcgtgccgcattgggccaattgggatcacttcaacgagctc
gataagaagggtctgatgatgtacggccagatgaccgctggttcgtggatttacatcggc
acccagggcatcgtgcagggcacctatgagacctttgccgaggcgggccgtcagcactat
ggcggggacctgacgggaaaatggatcctcaccggcggtcttggggggatggggggggcg
cagcctttggctgcggtttttgctggtgcttgctgccttgcggtggagtgcaaccccgac
tcgatcgatttccgcctgcgcaccaaataccttgatgagaaggctgaaacgctggacgaa
gcgctggagatgattgagcgttggaccaaggcgggcgaggccaaatccgttggccttttg
ggcaatgcggcggatgtgtttgcagagcttgtggagcgtgcgaaggcgggtggcatgcgc
cccgacatcgtgacggatcagacctcagcgcatgacccggtcaacggttatctgccgcaa
ggctggacgatggccgaatggagagagaagcgcgaaacggacaaaaaggcggttgagaaa
gcctctcgggcgtcgatgaaggctcatgtgaaggccatggtggatttccacgagatgggg
attcccaccgtcgattatggcaacaacatccgtcaagtcgcgctggaagaggggctggag
acggcgttctcattccccggatttgtgccagcctacattcgcccgctgttctgcaagggg
atcggtcccttccgttggtgtgcgctctcgggggatcccgaggatatccgcaagaccgat
gccaagatgaaagagctgttcccggagaacgagagcctgcaccgctggctcgacatggcg
caggaccgcatcgcctttcaggggctaccggcgcggatctgctggatcggccttggagat
cgccacaaggcggggcttgccttcaacgaaatggtgcgcaacggcgaattgtcggcgccg
gtcgtgattggccgagatcatcttgactcgggttccgtggcatcgcccaaccgtgaaacc
gaagcgatgatggatggatcggatgcggtctctgactggccattgctcaatgcgcttttg
aacacggcctcgggcgcgacatgggtttcgctgcatcatggcggcggtgttggcatgggg
ttttcgcagcactctggcgtggtgatctgctgtgacggcacagaggatgcagatcgccgg
atcgggcgcgttctgtggaacgacccggcgaccggcgtaatgcgtcacgcagacgcaggc
tatgagatcgcgaaggactgcgccaaagagcacggattgaacctgcccggtatcctgcgc
tcggaatga

DBGET integrated database retrieval system