KEGG   Ruegeria sp. TM1040: TM1040_3070Help
Entry
TM1040_3070       CDS       T00359                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sit  Ruegeria sp. TM1040
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TM1040_3070
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TM1040_3070
Enzymes [BR:sit01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TM1040_3070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RoseoBase: 
UniProt: 
Position
mega:39746..40705
Genome map
AA seq 319 aa AA seqDB search
MQPPSFDQPHLLGIEPLRPHEITAILDLAEDYVALNRQTEKHSDALAGLTQINMFFENST
RTQASFELAGKRLGADVMNMAMQASSIKKGETLIDTAMTLNAMHPDLLVVRHPHSGAVDL
LAQKVNCAVLNAGDGRHEHPTQALLDALTIRRAKGRLHRLNIAICGDVTHSRVARSNLIL
LGKMENRIRLIGPPTLVPQQFAEFGAEIYDDMREGLKDVDVVMMLRLQKERMDGGFIPSE
REYFYRYGLDAEKLALAKPDAIVMHPGPMNRGVEIDGTIADDIKRSVIQEQVEMGVAVRM
AAMDLLARNLRAARQKQAS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccccctctttcgaccagcctcacctcctcgggatcgagcccctcaggccacat
gagatcaccgccattctggatctggccgaagattacgtggcgctcaatcggcagaccgag
aagcactccgatgcgctggcggggctgacgcagatcaacatgttctttgaaaattccacc
cgcacgcaggccagctttgagctcgccggcaagcgactcggcgcggatgtgatgaacatg
gcgatgcaggcctcatcgatcaagaagggcgagacgctcatcgacaccgcgatgacgctc
aatgccatgcatccggatcttctggtggtgcgccatcctcactccggcgcggtggacctc
ttggcgcaaaaggtgaactgcgcggtgctgaacgcaggcgatgggcgccatgaacatccg
acgcaggcgcttttggacgcgctgacgatccggcgcgccaagggtcgtctgcatcggctg
aacatcgcgatttgtggcgatgtcacccattcgcgagtggcgcgctccaacctgatcctg
ctgggcaagatggaaaatcgcattcgcctgatcggcccgccaacgctggtgccacagcaa
tttgcggagtttggcgccgagatctatgacgatatgcgcgaaggtctaaaagacgtcgat
gtcgtgatgatgctgcggctccaaaaagagcggatggacggcggtttcattccttcggaa
cgcgagtatttctatcgctacggtctggatgcggaaaaattggcactggccaaacccgac
gccatcgtcatgcaccccgggccgatgaaccgcggcgtagaaatcgacgggaccatcgct
gatgatatcaaacgctccgtaatccaagagcaggtcgaaatgggcgtggccgttcgcatg
gccgcgatggatcttcttgcgcgcaacctgcgggcggcgcgtcagaaacaggcgtcctga

DBGET integrated database retrieval system