KEGG   Ruegeria sp. TM1040: TM1040_3135Help
Entry
TM1040_3135       CDS       T00359                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sit  Ruegeria sp. TM1040
Brite
Enzymes [BR:sit01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     TM1040_3135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
mega:111923..112831
Genome map
AA seq 302 aa AA seqDB search
MFERPTRIEFPTTEPYSPQRAALGKMLFFDARLSGAINMSCATCHNPSFGWETPASRAIG
AMNQPLARHTPTIENLTESEHFYWDGRIASLKEQIRGPITHPLKMNSSMRQVQRRLENIS
GYRRYFEIAFPDTGLTEDTILVALATYQRTLRSGWSPFDDWVEGDEDAISSSAQRGFDVF
TGRGQCVSCHQGWAFTDHDFHNVSLGDDDIGRGVLDPTMRYRFKTPGLRNIALRAPYMHN
GSLNSLRAVVEHYRRGGAPNTTASDIEPLTEMSDRDVNDLIAFLETLTAYAPHVSAPALP
VD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaagacccacccggatcgagtttcccacaacagaaccttactcgcctcaacgc
gccgctttgggcaaaatgttgttttttgatgcacgcctgtctggcgccatcaatatgagt
tgtgccacctgtcacaatccgtcgtttggctgggaaacaccggcatcccgcgcgattggc
gcgatgaatcagcccctggcgcgccacacccccacaatcgagaatctcacagaatcagag
catttctattgggacggacgcatcgcgtcgctcaaggaacagatacgcggcccgatcacc
cacccgctcaagatgaactccagcatgcgccaagttcagcgccggttggagaatatctca
ggttatcgtcgctatttcgagatcgcctttccagacaccggtctgacggaggacacaatc
ctggtggcgcttgcgacctatcagagaaccctgcgctcaggctggtctccgtttgacgac
tgggtcgagggtgacgaggacgcaatttcttcttccgcgcagcgtggctttgacgtcttt
accgggcgcggccaatgtgtgagctgccatcagggatgggccttcaccgatcatgacttt
cacaatgtcagcctcggagacgacgacatcgggcgcggcgtgctggacccgacgatgcgg
taccgcttcaagacgccggggctgcgcaacatcgcgctgcgcgcgccgtatatgcacaat
ggcagcctcaattctctgcgcgcggtggtggagcattaccgacgcggcggcgcgccgaat
acaaccgcgagcgacatcgaaccgctcaccgagatgagtgaccgcgatgtgaacgacctc
attgcattccttgaaaccctgacggcctatgcgccccatgtttcggctccggccctgcct
gtggactaa

DBGET integrated database retrieval system