KEGG   Ruegeria sp. TM1040: TM1040_3210Help
Entry
TM1040_3210       CDS       T00359                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sit  Ruegeria sp. TM1040
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sit02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sit02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
mega:205699..206634
Genome map
AA seq 311 aa AA seqDB search
MEAAYPGLQVLLANNLMMAYNQAEAGQPSFAFVEDGFTKLPEFEMMLALFSALDVRWVSV
MDDQNSTPARRSSPLLNVGAGIFELTKSDSPRQFIQYFDMMIKAPRRNAPRAAANKPPVG
RDDFKKVILIGSSTGGVEALRNVLVGFPINCPPTLIVQHTGKSFGTGLVSLLDRICPAKV
VAADDNITLQSGHVYIAAGQPRHMGVTPRKPFKIRMKEGPNISGHTPSVDALFSSAVPFA
RDVVAAILTGMGQDGAKGMLDLRKAGATTFAQDEKTAVVYGMPRVAWEIGAAQKQVPLAR
MANAILQASKT
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgcttacccggggttgcaagtgttgttggcgaataatctgatgatggcctac
aatcaggccgaggcaggccagccgagttttgcctttgtggaagatggctttaccaagctg
ccagagttcgagatgatgctggcgttgttttctgcactcgacgtacgttgggtctcggtc
atggatgaccaaaactcgacacctgcacgccgctcttcgccgctgttgaatgttggcgcg
ggtatcttcgaactgacaaaatccgacagcccgcgccagttcatccagtactttgacatg
atgatcaaagcaccgcgccgcaacgctccaagagcagcagcaaacaagcctccggtcggc
agagatgacttcaagaaggtcatcctgattggatcctccactggcggggttgaggcgctg
cggaatgttctggtggggttcccgataaactgcccaccgaccttgattgtccagcacaca
gggaaaagctttggcaccggtctggtgtcgcttctggatcggatctgtccggccaaggtg
gtggcggcggacgacaatatcactttgcagagtggacacgtctacattgcggctggccaa
cctcgacacatgggcgtcacgccgcgcaaacctttcaaaattcgaatgaaagaagggcca
aacatttcgggtcacaccccatcggttgacgcgttgttttcgtccgccgtgccatttgcg
cgagatgttgttgccgcaatattaactggtatggggcaagatggggccaagggcatgttg
gacctgcgcaaagcgggggccacaaccttcgcccaagacgagaaaaccgccgtggtctac
ggaatgccgcgggttgcctgggaaattggcgctgctcaaaaacaagttcccctggccagg
atggccaacgcaattctgcaagcatccaagacttaa

DBGET integrated database retrieval system