KEGG   Ruegeria sp. TM1040: TM1040_3430Help
Entry
TM1040_3430       CDS       T00359                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sit  Ruegeria sp. TM1040
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sit00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
mega:453595..454200
Genome map
AA seq 201 aa AA seqDB search
MEAAVTQALLVIDVQNDFCPGGALAVTEGDEVVAPINAMMERFDTVILTQDWHPKGHSSF
ASSHPGHAPFDTMEMYYGQQVMWPDHCVQGSQGAEFHPRLRTDGDMIIRKGFRPEVDSYS
AFFENDQTTPTGLEGYLRTRGISDLTLVGLATDFCVAFSALDARRLGFSVEVELAACRAI
DLDGSLATQLENMRQKGVKIS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcagtgacacaggctcttctcgttattgatgtgcagaatgatttttgcccc
ggtggcgcgctggcggtgacggagggcgatgaggtcgttgccccgatcaacgccatgatg
gagcggttcgacaccgtgatcctgacgcaggactggcatcccaaggggcattcgtccttt
gccagttctcatcccgggcatgcgccctttgacacgatggaaatgtattatggtcaacag
gttatgtggcccgatcattgtgttcagggcagccagggcgcagagtttcacccaaggctg
cgcactgacggggacatgatcatccgcaaagggtttcgccccgaggtggatagctattcc
gcgttttttgaaaacgaccagaccacgccgaccgggctcgaaggctacctgcgcacgcgc
gggatctcggatctgacactggtgggcctggccacggatttctgcgtcgcgttttcggct
ctggatgcgcgccgacttggtttttccgtggaagttgagctggcagcctgccgtgcaatc
gatctggatgggtccctggcaacgcagcttgagaatatgcgtcaaaaaggcgtgaaaatt
tcgtga

DBGET integrated database retrieval system