KEGG   Ruegeria sp. TM1040: TM1040_3440Help
Entry
TM1040_3440       CDS       T00359                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sit  Ruegeria sp. TM1040
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TM1040_3440
Enzymes [BR:sit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TM1040_3440
Exosome [BR:sit04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TM1040_3440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
mega:465392..466876
Genome map
AA seq 494 aa AA seqDB search
MTYILAIDQGTTSTRAILFDGDMQVAAVAQEEFTQHYPNAGWVEHDPEDLWSTTLATCRK
VMADKGISASDIAGIGITNQRETTVVWDKATGRAIHNAIVWQDRRTAEICEGLRDEGHED
MVRETTGLLLDPYFSGTKVKWILDTVEGARARAEAGDLLFGTIDSFLIWRLTNGQSHVTD
ATNAARTLMYDIKSGSWSTEICAMLEVPQAMLPDVLDSAADFGTTSPDHFGGAIPILGVA
GDQQAATVGQTCFKPGMMKSTYGTGCFALLNTGDTPVLSKNRMLTTIAYQLDGKPTYALE
GSIFIAGAAVQWLRDGLGIIGKASESGVLADKADPTQDVILVPAFTGLGAPYWEPDCRGG
MFGLTRNSGPAEFARAALQSVAYQTRDLWEAMRADWEGEANVTLRVDGGMSASDWAMQSL
SDTLGAAVDRPVMQETTALGAAWLAGMKAGVYPDQEGFAATWALDREFKPKLDAARREEA
YARWKRAVQAVIGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacctatattctcgcgattgatcaagggacgacttcgacccgcgcgatcctgtttgac
ggtgacatgcaggtcgccgctgtggcgcaggaggagtttacccagcattaccccaatgcg
ggatgggtggaacacgaccccgaggacctttggtccacgaccctggcgacttgccgcaaa
gtgatggcagacaaaggtatttccgcctctgatattgccgggatcggcatcaccaaccag
cgcgaaaccaccgttgtctgggacaaggccaccggccgcgcgatccacaacgcgattgtc
tggcaggaccgccgcaccgccgagatctgcgaaggtctgcgcgacgaaggccatgaggac
atggtgcgcgaaaccacggggcttttgcttgatccctatttctccggcaccaaggtcaaa
tggattctcgacactgtcgagggggcccgcgcccgtgccgaggccggtgatctgctgttt
ggcaccatcgacagttttctgatctggcgtctcacgaacgggcagtcgcacgtcacggac
gccaccaacgcggcgcgcaccctgatgtatgacatcaagtccggcagctggagcacagag
atctgcgccatgctggaggtgccgcaggccatgctgcccgatgtgctcgacagcgcggca
gacttcggcaccacgtccccggaccattttggtggcgcgatccccatcctgggcgttgcg
ggcgatcagcaggcggcgacagtgggccagacctgtttcaagccggggatgatgaaatcc
acctatggcaccgggtgttttgcactcttgaacacgggcgatacgccggtgctgtcaaag
aaccgcatgctcacaaccatcgcctaccagctggatggcaaacccacctatgcgctcgaa
ggctcgatctttatcgcaggcgcagcggtgcaatggttgcgcgacgggcttggcatcatc
ggcaaggccagcgagtccggggtgctggctgacaaggcggatccaacccaggacgtgatc
cttgtgcccgcctttacaggccttggcgcaccctactgggaaccggactgccgcggcggc
atgtttggcctcacccgcaactcgggccctgcggaatttgcccgcgccgcgttgcagagt
gtggcctaccagacccgcgacctctgggaggcgatgcgcgccgactgggaaggagaggcc
aatgtcaccctgcgcgtcgatggcggcatgagcgccagcgactgggccatgcagagcctc
tccgacacgcttggcgctgccgtcgatcgccccgtcatgcaggaaaccaccgcgctgggc
gcggcgtggcttgcgggcatgaaagcaggcgtctaccccgatcaggagggctttgcggcc
acttgggccctggatcgcgagtttaaaccaaagctcgacgctgcccgtcgcgaagaggcc
tatgcccgttggaaacgcgccgtgcaggctgtcatcggagtctga

DBGET integrated database retrieval system