KEGG   Ruegeria sp. TM1040: TM1040_3443Help
Entry
TM1040_3443       CDS       T00359                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
sit  Ruegeria sp. TM1040
Pathway
sit02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sit00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TM1040_3443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C CCP_MauG
Motif
Other DBs
NCBI-ProteinID: ABF62415
JGI: TM10403443
RoseoBase: TM1040_3443
UniProt: Q1GLQ1
Position
mega:complement(468998..469465)
Genome map
AA seq 155 aa AA seqDB search
MKSILSTAIVFALTLPVTAWAEGDPEAGQKAFNKCKSCHQIVSDTGETLSKGGRTGPNLW
GIAGRQAGTVEDFRYGDDLVAAGEAGLVWDAETFAAYTADPRGFLREFLEDNKAKSKMAF
RLKTGGEDVYAYLAQFGPAPAEAEAEASDNENASD
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgattctcagtacagccattgtgtttgccctcacgcttcccgtcacggcatgg
gccgaaggcgatcccgaagccgggcaaaaggcgttcaacaaatgcaagtcctgccatcag
atcgtctctgacacaggcgaaacactctccaaaggagggcgcaccgggcccaatctttgg
gggatcgcgggccgtcaggcgggcaccgttgaggattttcgctatggcgatgacctggtt
gcagcgggcgaagccggtcttgtctgggacgctgagacatttgccgcatataccgcagac
ccgcgggggttcttgcgggaattcctggaagacaacaaagccaaatccaaaatggccttt
cgcctgaagaccggtggcgaggatgtctatgcctatctcgcccaatttggccccgccccg
gcagaggctgaggccgaggcctccgacaatgagaacgccagcgactga

DBGET integrated database retrieval system