KEGG   Ruegeria sp. TM1040: TM1040_3486Help
Entry
TM1040_3486       CDS       T00359                                 

Definition
glycoside hydrolase, clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sit  Ruegeria sp. TM1040
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TM1040_3486
  Lipid metabolism
   00561 Glycerolipid metabolism
    TM1040_3486
   00600 Sphingolipid metabolism
    TM1040_3486
Enzymes [BR:sit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TM1040_3486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
mega:517580..519646
Genome map
AA seq 688 aa AA seqDB search
MSDGLQLWRIDAPGQTLVLSSDGGLPGALYWGPALQPETDLIALARAVEQEVTGGMIDRL
PPLSLCPEAGLSFEGQPGLVAYRDGAPLYPRFRLEDTNGAQFTCRDRALGLTLFFDFEVR
GGTIAASTTLTSEQDIILHHLAAPVLPGPQMGQEIVDVCGRWIGEFQLQRTPWRAGIHKR
EARTGRSGHEHPPLAYFPEAGATNTHGTVFAMHYGWSGGHVMLAEELPSGRRQIQWGHAT
GTQGAGTKFRSAPLYLAVSQAGFNGCAVAFQRLLSDHVVVWPKPETPRPVHYNCWEAVYF
DHDFTVLSDIAERAAALGAERFVLDDGWFGRRDDDTTSLGDWQIDRRKWPEGLGPLIDHV
ERLGMTFGLWVEPEMVNLDSDLARAHPDWVLGPVDQIEGRQQRVLDLSREDVREHLFQVL
SALLSENRIDYLKWDHNRLLPIADAAQTEGIYALLRDLRSAFPKVEIESCASGGGRIDAG
ILSLTQRVWLSDSNDALERMRIQHDAALLLPLSVTGSHVGPRTCHTSGRTIDIHMRAWVA
AQRHMGFEMDPRELTPTEIEALTRVTTWWKNNRNWRMQADILRLDAPDQSVIAEQQMAAD
ASRFVVFAGKARSVHQILPRPLRLTELDPKAQYRIDLVNREALHHLSRGRTALKDGPLTL
SGEILMQQGLTLPWQFPETIWVIEGEKL
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgggctgcaactctggcggatcgatgcgccgggtcaaacgctggtgctgtcg
tccgatggcggtctgcccggcgcgctctactggggccctgcgctgcagccggagacggat
ctgatcgcactggcgcgcgccgttgaacaagaggtgacaggcgggatgatcgaccggctg
ccgcccttgtcgctctgcccggaggccgggctctcctttgagggtcagccggggctggtt
gcctatcgtgacggagcgccgctttatccacgctttcgcctcgaagacaccaacggcgcg
cagtttacctgccgtgatcgcgcgctaggactgacgctgttctttgacttcgaggtgcgg
ggcgggacgattgcggcctcgaccacgctgacctcggagcaggacatcatcctgcaccat
ctcgctgcgcccgttctgccgggtcctcagatggggcaggagattgtcgatgtctgtggc
cgctggatcggtgaattccaactgcaacgcaccccatggcgcgcgggcattcacaagcgc
gaggcccgtaccgggcgttcggggcacgagcacccgcccttggcctattttcccgaggcg
ggcgcgaccaacacccacggcaccgtttttgccatgcattacggctggtccggcgggcat
gtgatgctggccgaagagctgccctctgggcggcgccagatccagtggggccatgccacg
ggcacgcaaggcgcagggacaaagttccgcagcgcgcccctctacctggcggtgtcgcaa
gcagggttcaacggttgtgcagtggcctttcagcgtctgctcagcgatcatgtggttgtc
tggcccaagcccgaaactccgcgtccggtgcattacaactgctgggaagcggtctatttc
gatcatgacttcactgtcctgagcgacattgccgagcgcgccgcggccctgggtgcagaa
cggtttgtgcttgatgatggctggtttggcagacgcgatgatgacaccacctcccttggg
gattggcagatcgaccggcgcaaatggcccgaggggctaggcccgctcattgatcacgtc
gaacgcctagggatgacatttggtctctgggtcgagccggaaatggtgaacctcgacagt
gatctggcgcgggcacatcccgactgggtcttggggcctgtggatcagatcgaaggccgc
cagcagcgggtgttggacctgtcgcgcgaagacgtgcgagagcatctttttcaagtgctg
tccgcgctcttgagcgagaaccgcatcgactacctgaaatgggaccacaaccgcctgttg
ccgattgcggatgcggcccagacggagggtatctatgccctgttgcgggaccttcgcagc
gcgttccctaaggtcgaaatcgagagctgcgcctccggcggcgggcggatcgacgcgggt
atcctgagcctcacgcagcgggtttggctctcggacagcaatgacgcgctggagcggatg
cgcattcagcatgatgcggcgctcctgttgccactatccgtgacgggctctcacgtaggg
ccgcgcacctgccatacctccgggcgaaccatcgatatccacatgcgcgcctgggtcgcc
gcccagcggcacatggggtttgagatggatccgcgcgagctgaccccgacagagatcgag
gcgctgacgcgagtcacaacctggtggaaaaacaatcgcaactggcgcatgcaggcggat
atcttgcggttggatgcgcctgatcaaagcgtgatcgcagagcagcagatggccgcggat
gccagccgctttgtggtgtttgcgggcaaggcacggagcgtgcatcagatcctgccgcgc
cccttgcgcctgacagaacttgaccccaaagcccaataccggatcgatctcgtcaaccgc
gaggcgttgcaccacctgtcgcgcgggcgcaccgcgctcaaggacgggccgcttacgctc
agcggtgagattctgatgcagcaggggctgactctgccctggcaatttcctgaaacgatc
tgggtgatcgaaggagaaaaactatga

DBGET integrated database retrieval system