KEGG   Ruegeria sp. TM1040: TM1040_3510Help
Entry
TM1040_3510       CDS       T00359                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sit  Ruegeria sp. TM1040
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TM1040_3510
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TM1040_3510
  Amino acid metabolism
   00310 Lysine degradation
    TM1040_3510
Enzymes [BR:sit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TM1040_3510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
mega:complement(544384..545889)
Genome map
AA seq 501 aa AA seqDB search
MTTEVRVPTLGESVTEATVATWFKKPGDTVAADEMLCELETDKVTVEVPAPAAGTLAEIV
AKEGDTVGVDALLANITEGGAAAASAPAAKPAPAEAPASSGGDAVDVMVPTLGESVSEAT
VSTWFKKVGDSVAQDEMLCELETDKVSVEVPAPAAGVLAEITAPEGTTVDASAKLGVISG
DGAAVAAAPAAAPAAAETPAAVSKDVANAPSAEKAMAEAGLSASDVKGTGRDGRIMKEDV
ASAIAAAKSAPAPTAAPAAPRAPVSADDASREERVKMTRLRQTIAKRLKDSQNTAAMLTT
YNEVDMTEVMALRNEYKDLFLKKHGVKLGFMSFFTKACCHALKEVPEVNAEIDGTDIVYK
NFVHMGIAAGTPTGLVVPVIRDADAMSFADIEKAIAEKGARARDGKLSMAEMQGGTFTIS
NGGVYGSLMSSPILNPPQSGILGMHKIQDRPMAINGKVEIRPMMYLALSYDHRIVDGKGA
VTFLVRVKEALEDPRRLLMDL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgaagtgcgcgtgcccactctgggcgaatccgtgaccgaagccaccgtcgcc
acctggttcaagaagccgggcgacactgttgccgcagacgagatgctctgtgagctggaa
accgacaaggtcacagtcgaagtgcccgccccggcggctggcactctggccgagatcgtt
gccaaggaaggcgacaccgtgggcgttgatgcgctcctggccaatattaccgaaggcggc
gccgcagcagcctcagccccggcagcgaaacccgccccggctgaggcacctgcctcttcg
ggtggggatgctgttgacgtgatggtgccgacgctgggcgaaagcgtctctgaggcgacc
gtttccacatggttcaagaaagtcggtgacagcgtcgcgcaggacgaaatgctttgcgag
ctggaaaccgacaaggtttccgtcgaggtgcccgcgcctgccgctggcgttctggccgag
atcaccgcgcccgaaggcaccaccgtggacgcctctgccaaactcggcgtcatctccggt
gacggtgcagcggtagcggcggccccggctgcagcgcccgctgcggcggagacccctgcc
gccgtctccaaggatgtcgccaatgcgccatcggcggaaaaggcgatggccgaggccggt
ctctccgcatcggatgtcaaaggcacaggccgcgacggacgcatcatgaaagaggacgtg
gcatcggcgatcgccgccgcaaaatccgcgcccgccccgacagcggctcccgcagccccg
cgcgcgccggtgtctgccgatgatgcctcgcgcgaagaacgcgtaaaaatgacccgtctg
cgccagaccatcgccaagcgtctgaaggacagccagaacactgctgccatgctcactacc
tacaatgaggtcgacatgaccgaggtgatggcgctgcgcaacgaatacaaagacctgttc
ctgaagaagcacggcgtgaaactgggctttatgtccttcttcaccaaggcctgctgccac
gcgttgaaagaggtccccgaggtcaacgccgagatcgacggcaccgacatcgtctacaag
aacttcgtccacatgggcatcgccgcaggcacgcccacgggtctggtggttccggtcatc
cgcgacgccgatgcgatgtcctttgccgatattgagaaggcgattgccgaaaaaggcgcg
cgcgcccgtgacggcaagctgtcgatggcggaaatgcagggcggcaccttcaccatctcc
aacggtggtgtctatggctcgctgatgtcctcgccgatcctgaacccgccgcagtccggt
atcctcggcatgcacaagatccaggaccgcccgatggcaatcaacggcaaggtggaaatc
cgcccgatgatgtatctggcgctgtcctatgaccaccgtatcgtcgacggcaaaggcgct
gtgaccttcctcgtgcgcgtcaaagaagcgctggaagatccccgccggttgttgatggat
ctgtaa

DBGET integrated database retrieval system