KEGG   Ruegeria sp. TM1040: TM1040_3526Help
Entry
TM1040_3526       CDS       T00359                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sit  Ruegeria sp. TM1040
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TM1040_3526
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TM1040_3526
   00650 Butanoate metabolism
    TM1040_3526
  Energy metabolism
   00190 Oxidative phosphorylation
    TM1040_3526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
mega:560420..560791
Genome map
AA seq 123 aa AA seqDB search
MNYLTDRKRAEGLGAGGAGTHHHWQMMVSSILLVVLVPAFVITFGLGLGGTYEEVLAYYG
RPVPAIITGLTLVVGIIHLMREAQVAVEDYMHGLAEKLTLIAVAALSYTMIAAGLFALVK
LAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaactatctaactgaccgcaaacgcgcagaaggccttggggccgggggggcaggcacc
catcatcactggcagatgatggtgagctcgatcctccttgtggttctggtgccggccttt
gtgatcacctttgggcttggtctcggtggcacctacgaagaggtgctggcttactatggc
cgtccggtgcccgcgatcatcactggtctcacgctggtggttggcatcatccatctgatg
cgcgaggcgcaggtcgcggtggaggactacatgcatgggctggcggaaaagctgacgctg
atcgcagttgcagccctgtcctacacgatgattgccgcggggctttttgccctcgtcaag
ctcgccctgtga

DBGET integrated database retrieval system