KEGG   Setaria italica (foxtail millet): 101752877Help
Entry
101752877         CDS       T02818                                 

Gene name
PPC1
Definition
phosphoenolpyruvate carboxylase 1 (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Class
Metabolism; Overview; Carbon metabolism [PATH:sita01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sita00620]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:sita00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 961 aa AA seqDB search
MASERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREFVQECYEL
SAEYENDRDEARLGELGSKLTSLPPGDSIVVASSFSHMLNLANLAEEVQIAHRRRIKLKR
GDFADEASAPTESDIEETLKRLVSQLGKSREEVFDALKNQTVDLVFTAHPTQPVRRSLLQ
KHGRIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYF
HETIWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVC
LLARMMAANLYFSQIEDLMFELSMWRCSDELRIRADELRRSSKRAAKHYIEFWKQVPPNE
PYRVILGDVRDKLYYTRERSRHLLTTGISEIPEEATFTNVEQFLEPLELCYRSLCACGDK
PIADGSLLDFLRQVSTFGLALVKLDIRQESDRHTDVLDSITKHLGIGSYAEWSEEKRQDW
LLSELSGKRPLFGSDLPLTEETADVLGAFHVLAELPADCFGAYIVSMATAPSDVLAVELL
QRECHVKHPLRVVPLFEKLADLKSAPAAVARLFSIDWYMDRINGKQEVMIGYSDSGKDAG
RLSAAWQMYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGSLR
VTVQGEVIEHSFGEEHLCFRTLQRYTAATLEHGMHPPISPKPEWRALMDEMAIVATKEYR
SIVFQEPRFVEYFRSATPETEYGRMNIGSRPSKRKPSGGIESLRAIPWISAWTQTRFHLP
VWLGFGAAFKHLMQKDIRNIHTLKEMYNEWPFFRVTLDLLEMVFAKGDPGIAAVYDKLLV
AEDLQSFGEQLRKNYEETKELLLQVAGHKDVLEGDPYLKQRLRLRESYITTLNVCQAYTL
KRIRDPGFQVSPQPALSKEFTDESQPAQLVQLNPESEYAPGLEDTLILTMKGIAAGMQNT
G
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgagcggcaccagtcgatcgacgcgcagctgcggctgctggcgccaggcaag
gtctccgaggacgacaagctcgtcgagtacgacgccctcctcgtcgatcgcttcctcgac
atcctccaggacctgcacggcccgcacctccgcgaattcgtgcaggagtgctacgagctc
tcggcggagtacgagaacgaccgcgacgaggcgcggctcggcgagctcgggagcaagctc
accagcctgccccccggggactccatcgtcgtcgccagctccttctcgcacatgctcaac
ctcgccaacctcgccgaggaggtgcagatcgcgcaccgccgccggatcaagctcaagcgt
ggggactttgccgacgaggcctcggcgcccaccgagtccgacatcgaggagacgctcaag
cgcctcgtctcgcagctcggcaagtcgcgcgaggaggtcttcgacgcgctcaagaaccag
accgtcgatctcgtcttcacggcgcaccccacgcagcccgtcaggaggtccctgctccag
aagcatggcaggatccggaattgcctgaggcaactgtatgccaaggacatcactgctgat
gacaagcaggagcttgatgaggctcttcagagggagattcaagctgcttttagaactgat
gaaatccgcagaacccctcccactcctcaagatgaaatgcgtgctggaatgagttacttc
catgaaactatatggaagggcgtaccaaaattcttgcgccgtattgacactgctctgaaa
aatattgggatcaatgagcgtctcccttacaatgctcctctcattcagttctcttcctgg
atgggtggtgaccgtgatggaaatccaagagttacaccagaggttacacgggatgtatgc
ttattggcaagaatgatggctgctaacttgtacttctctcagatagaagatctgatgttt
gagctctctatgtggcgctgcagtgatgaacttcggatccgtgcagatgaattacgtcgg
tcatcaaaaagagctgcaaagcactatatagaattctggaagcaagttcctccaaacgaa
ccttatcgtgtcatccttggtgatgtcagggataaactgtactatacgcgtgaacgttct
cgtcatttattgacaactggaatttctgagattcctgaggaggcaacttttactaatgtt
gaacagtttctagaacctcttgagctctgttatagatcattatgtgcctgtggtgacaaa
cccatagccgacggaagtctccttgatttcttgcgtcaagtatccactttcgggcttgct
cttgtgaaacttgacatcaggcaggaatctgatcggcacactgatgtccttgattcaata
actaaacatcttggaattgggtcctatgctgaatggtctgaggagaaacgccaggattgg
ctgttgtctgaactgagcggcaagcgtccattgtttggttctgatcttcctctgactgaa
gagaccgccgatgttttaggcgcatttcatgtcctagcagagctcccagcagattgcttt
ggcgcgtatatcgtctcgatggcaactgccccctccgatgtgcttgctgtcgagctttta
cagcgtgagtgccatgtaaagcatccactgagagttgttccactctttgagaaacttgca
gacttgaagtcagctccagcagctgtagcacgactcttttcaattgactggtacatggat
aggattaatggcaagcaggaggtgatgattggatactcagactctggtaaagacgctgga
cgtctctctgcagcgtggcaaatgtataaagcacaagaggagctcatcaaggtggcaaag
cagtatggagtgaagttgaccatgtttcatggaaggggtggaacagttggcagaggaggt
ggtcccactcatttggccatattatctcagccaccagacacgatacatggatcacttcgt
gtaacagtgcaaggtgaggtcattgagcactcctttggagaggagcacctgtgctttaga
actttgcaacgctacactgcagctacccttgagcatggcatgcatcctccaatttcccca
aagccggaatggcgtgctctgatggatgaaatggctattgtggcaaccaaagaatatcgg
tcaattgtcttccaagaaccacgctttgttgaatacttcagatcggctacacctgagact
gaatatggtaggatgaatattggcagccgtccatcaaagaggaagcctagtgggggaata
gaatcgctccgtgcaattccatggatctctgcttggacgcaaacaaggttccatctccct
gtttggcttggatttggcgcagcattcaagcatctcatgcagaaggacatcaggaacatc
catactcttaaagaaatgtacaatgagtggccattcttcagggttacccttgacttgctt
gagatggttttcgccaagggagacccaggaatcgcggctgtgtatgataaattgctggtg
gctgaagatctgcagtcctttggagagcagctaaggaagaactatgaggagacaaaagag
ctgctccttcaggtcgccggtcacaaggacgtcctcgaaggtgatccttacctgaagcag
cgtctgcggctgcgtgagtcgtacatcaccaccctgaacgtctgccaggcctacaccctg
aagcggattcgtgaccctggcttccaggtgagcccccagccggctctgtccaaggagttc
accgacgagagccagccggcgcagctggtgcagctgaaccccgagagcgagtacgcgccg
ggcctggaggacacgctgatcctgaccatgaagggtatcgccgccgggatgcagaacacc
ggctag

DBGET integrated database retrieval system