KEGG   Setaria italica (foxtail millet): 101753020Help
Entry
101753020         CDS       T02818                                 

Definition
(RefSeq) beta-amylase 8
Organism
sita  Setaria italica (foxtail millet)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
I
AA seq 655 aa AA seqDB search
MKLPHPHPPLVLGEEEPSPPPQRRPRGFASGPAPSAGAAGPPRRRGEREREREKERTKLR
ERHRRAITSRMLAGLRQHGNFPLPARADMNDVLAALARAAGWTVQPDGTTFRSSNPPSLS
PPPPSQLGMFQVAPVETPAFISTLNSYAIGTPLDSQASALQTDDSLSPSSLDSVVAERSI
KTENYGNSSSANSLNCMDNDQLLRSSAVLAGDYTKTPYIPVYASLPMGIINNHCQLVDPE
GVRAELRHLKSLNVDGVVVDCWWGIVEAWIPRKYEWSGYRDLFGIIKEFKLKVQVVLSFH
VSGGTGSGDVLISLPKWIIEIAKENQDIFFADREGRRNTECLSWGVDKERVLRGRTGIEV
YFDFMRSFHMEFRNLSEEGLISAIEIGLGASGELRYPSCPERMGWKYPGIGEFQCYDRYM
QKNLRQSAASRGHLFWARGPDNAGYYNSRPRETGFFCDGGDYDSYYGRFFLNWYSGVLID
HVDQVLSLATLAFDGAEILVKIPSIYWWYRTASHAAELTAGFYNPTNRDGYSPVLKMLKK
HSVILKLVCYGPEFTVQENDEACADPEGLTWQVVNAAWDHGLSLCIESALPCLDGDMYSQ
ILDTTKPRNDPDRHHASFFTYRQQPPSLLQRDAYFPELRTFVKCMHGEAPQNGED
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcccacacccgcacccgccgctggtgctgggggaggaggagccatccccgccg
ccgcaacgccggccgcgcggcttcgcctcgggtcccgcgccgtcggcgggggcggcgggg
ccgccgcggaggcggggcgagcgggagcgggagagggagaaggagcggacgaagctgcgg
gagcggcaccgacgcgccatcacgagccgcatgctggccgggctgcggcagcacggcaac
ttcccgctccccgcccgcgctgacatgaacgacgtcctcgccgccctcgcccgcgccgcc
ggatggaccgtgcaacccgacggcaccaccttccgctcctcgaacccaccatcgctgtct
cctccccctccttcccagttgggcatgtttcaagttgctccagtggaaacgccagctttc
atcagcactctgaacagttacgccatcggaacaccattagactctcaggcttctgcccta
caaacagatgatagtctgtcgccatcgtcgctggactcagttgtggcagagagaagcatt
aagaccgagaactatgggaattccagttcagccaattctctgaattgtatggacaatgat
cagttactgagatcatcggcagtgttggcaggtgattacacaaaaactccatatataccg
gtttatgcttctctgcctatgggcattatcaataaccactgccaattggtcgacccggag
ggtgtccgcgctgaactaaggcatctgaagtctttgaacgtagatggggttgttgttgac
tgttggtgggggattgtggaagcctggattcctcgcaagtatgagtggtctggctacagg
gacctttttggtataattaaagagttcaagctcaaagttcaggttgtgttgtcatttcat
gtatctggaggtactggatctggtgatgtgttaatctctctcccaaaatggatcattgaa
attgcaaaagagaaccaggacatatttttcgcagaccgcgaaggcagaagaaacacagaa
tgcctttcttggggggttgacaaagaacgagtccttagagggagaactggcattgaggtc
tattttgatttcatgaggagcttccatatggaattcagaaacctatctgaagagggtctt
atctctgctattgaaattggattgggtgcttcaggggagctaagatacccttcatgccca
gaaagaatgggctggaaatatcctggtatcggtgagtttcagtgttatgacaggtacatg
caaaagaatttacggcaatcagcagcgtcacggggtcatttgttttgggcacgtgggcct
gataatgctggctattataattcaagaccacgtgaaactggcttcttttgtgatggaggt
gattatgacagctactatggacgttttttcctcaactggtattctggagtcctcatagat
catgtggatcaggtgctctcacttgctactcttgcatttgatggagcagaaatacttgtg
aagattccatctatctattggtggtacagaactgcaagccatgctgcagagcttacagca
ggattctacaatcctacaaacagagatggatactccccagttctcaaaatgctcaagaag
cattctgtgattcttaagctagtttgttatgggccagagtttacagttcaggagaatgat
gaagcatgtgcggatccagaaggattaacctggcaggttgtgaatgcagcatgggatcat
gggctgtctctatgtatagagagtgcacttccatgtcttgatggtgacatgtactctcaa
atccttgacacaacgaagcctaggaatgatcctgatcgccatcatgcctcgttctttaca
taccgccagcagcctccatcccttttgcagagagatgcctacttcccggaacttcgtacc
ttcgttaagtgtatgcacggggaggctccccagaatggagaagattga

DBGET integrated database retrieval system