KEGG   Setaria italica (foxtail millet): 101754295Help
Entry
101754295         CDS       T02818                                 

Definition
NADH--cytochrome b5 reductase 1-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sita00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 279 aa AA seqDB search
MEFLQGQRLETTVALAVAVVAVAAGAAYLFLRSRKPMGCLDPETFREFKLVEKRQLSHNV
AKFKFALPTPTSVLGLPIGQHISCRGQDAAGEEVIKPYTPTTLDSDLGHFELVIKMYPQG
RMSHHFREMKVGDYLSVKGPKGRFKYQPGQVRAFGMIAGGSGITPMFQVTRAILENPEDN
TKVHLIYANVTYDDILLKEELDSMAKNYPDRFKIYYVLNQPPEIWDGGVGFVSKEMIQAH
CPAPAADIQVLRCGPPPMNKAMAAHLDDLGYTKEMQFQF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggagttcctgcaggggcagaggctggagaccacggtggccctcgcggtcgccgtcgta
gccgtggccgccggcgccgcctacctcttcctccgcagcaggaagcccatgggttgcttg
gaccctgagaccttcagggagtttaaactcgtcgagaagaggcaactgagccataatgtt
gccaagttcaagtttgcgcttccgacacctacttctgtcttgggtcttccaataggacaa
catataagctgcaggggacaggatgccgctggtgaggaagtaatcaagccttatactccc
actacactggactctgatctcgggcactttgagcttgttattaagatgtacccccaagga
agaatgtctcatcattttcgtgagatgaaagtcggcgactatttgtctgtgaagggacct
aagggccgtttcaagtaccaacctggacaagtgagagcatttggaatgatagctggagga
tcaggcatcaccccaatgttccaagttacaagggcaattcttgagaacccagaagacaat
acaaaagttcacctaatctatgcgaatgtcacatatgatgatattcttctgaaggaagaa
ctggacagtatggcaaaaaactatcccgatcgtttcaagatctactatgtcttgaatcag
cctcctgaaatctgggacggcggtgttgggttcgtgtcaaaggaaatgatccaagcccat
tgcccagcgcctgctgccgacatccaggtgttgagatgcgggcctcctcccatgaacaaa
gccatggccgcgcacctggacgatcttggctacacgaaggaaatgcagttccagttctga

DBGET integrated database retrieval system