KEGG   Setaria italica (foxtail millet): 101754295Help
Entry
101754295         CDS       T02818                                 

Definition
NADH--cytochrome b5 reductase 1-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101754295
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     101754295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 279 aa AA seqDB search
MEFLQGQRLETTVALAVAVVAVAAGAAYLFLRSRKPMGCLDPETFREFKLVEKRQLSHNV
AKFKFALPTPTSVLGLPIGQHISCRGQDAAGEEVIKPYTPTTLDSDLGHFELVIKMYPQG
RMSHHFREMKVGDYLSVKGPKGRFKYQPGQVRAFGMIAGGSGITPMFQVTRAILENPEDN
TKVHLIYANVTYDDILLKEELDSMAKNYPDRFKIYYVLNQPPEIWDGGVGFVSKEMIQAH
CPAPAADIQVLRCGPPPMNKAMAAHLDDLGYTKEMQFQF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggagttcctgcaggggcagaggctggagaccacggtggccctcgcggtcgccgtcgta
gccgtggccgccggcgccgcctacctcttcctccgcagcaggaagcccatgggttgcttg
gaccctgagaccttcagggagtttaaactcgtcgagaagaggcaactgagccataatgtt
gccaagttcaagtttgcgcttccgacacctacttctgtcttgggtcttccaataggacaa
catataagctgcaggggacaggatgccgctggtgaggaagtaatcaagccttatactccc
actacactggactctgatctcgggcactttgagcttgttattaagatgtacccccaagga
agaatgtctcatcattttcgtgagatgaaagtcggcgactatttgtctgtgaagggacct
aagggccgtttcaagtaccaacctggacaagtgagagcatttggaatgatagctggagga
tcaggcatcaccccaatgttccaagttacaagggcaattcttgagaacccagaagacaat
acaaaagttcacctaatctatgcgaatgtcacatatgatgatattcttctgaaggaagaa
ctggacagtatggcaaaaaactatcccgatcgtttcaagatctactatgtcttgaatcag
cctcctgaaatctgggacggcggtgttgggttcgtgtcaaaggaaatgatccaagcccat
tgcccagcgcctgctgccgacatccaggtgttgagatgcgggcctcctcccatgaacaaa
gccatggccgcgcacctggacgatcttggctacacgaaggaaatgcagttccagttctga

DBGET integrated database retrieval system