KEGG   Setaria italica (foxtail millet): 101755326Help
Entry
101755326         CDS       T02818                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5-like
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
sita  Setaria italica (foxtail millet)
Brite
Enzymes [BR:sita01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101755326
Peptidases [BR:sita01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101755326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 389 aa AA seqDB search
MILPTKFDSFATIIGLCVQPCPILGPPLPATTNFCITRMHLYCCHFLCSELESQHLNMPW
AAIENDPGVFTELLQQMQLKGLQVDELYSLDLDALNDLQPIYGLIVLYKWRPPEKDERPV
IKDTVPNLFFANQIINNACATQAILSVLLNSPGITLSDELKKLKEFAKDLPPELKGLAIV
NCSSIRILNNSFARSEVPEEQKPSSKDDDVYHFISYVPVDGVLYELDGLKEGPISLGKCP
GGVGEAGWLRVAQPVIQEHIDRFTQNEIRFSVMAILKNRKEMYTAELKDLQRKRENLLQQ
MGDPSARHVPSVEQSLAEVAAQIEAVTEKIIMEEEKVKKWKTENMRRKHNYVPFLFNFLK
ILEEKQQLKPLIEKAKAKHKSHSHSTNPR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgattttacctactaaattcgattcttttgcaacaattattgggttatgtgtacaacca
tgtcctatactgggtcctcccctgcccgctaccaccaatttctgcataaccagaatgcat
ctttattgctgtcactttctatgctcagaattggagtcacaacatctcaacatgccttgg
gctgcaatcgagaatgatcctggtgtttttacagaattgttgcagcagatgcaactgaag
ggtcttcaagttgatgaactctactcacttgacctggatgctctcaatgatcttcagcca
atatatgggctcatagtgctgtacaaatggcgacctccagaaaaggatgagcgccctgtc
atcaaggatacagtcccaaaccttttctttgccaaccagataattaataacgcgtgtgca
acccaagctatcctttctgttctcttgaactctcctggtatcacccttagcgatgagctt
aaaaagctgaaggaatttgcaaaggacttgccacctgagctcaagggattggcaatagtg
aattgctcaagcatccgtatcttgaacaactcatttgcaaggtcagaggtccccgaggag
cagaaaccatctagcaaggatgacgatgtctaccacttcataagctatgttccagtggat
ggagtcctgtatgaactcgatggacttaaggaagggccgataagcctggggaaatgccca
ggtggtgtcggtgaggcggggtggcttagggtagcgcagcctgtgattcaagagcacatt
gatcggttcactcagaatgagataaggttcagtgtgatggcaatcttgaagaaccggaag
gagatgtacacagcagagctgaaagacctgcagaggaagagggagaacctcttgcagcag
atgggcgatccttctgccaggcatgtgccatctgtcgagcagtctctagcagaggtggct
gctcagatcgaggctgtgacggagaaaatcataatggaggaagagaaggtgaagaagtgg
aagacagagaacatgaggaggaagcacaactatgtgccgttcttgttcaatttcctcaag
attctcgaggagaagcagcagttgaagcccctgatagagaaggcaaaggcgaaacacaag
tctcacagtcacagcaccaaccctaggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system