KEGG   Setaria italica (foxtail millet): 101756659Help
Entry
101756659         CDS       T02818                                 

Definition
(RefSeq) probable choline kinase 2
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00564  Glycerophospholipid metabolism
sita01100  Metabolic pathways
Module
sita_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101756659
Enzymes [BR:sita01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     101756659
    2.7.1.82  ethanolamine kinase
     101756659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Haspin_kinase DUF1679
Motif
Other DBs
NCBI-GeneID: 101756659
NCBI-ProteinID: XP_022682999
Position
V
AA seq 361 aa AA seqDB search
MVAVDPPPRGEATAAAPAPVLRRSASIERIPEDARRILHRLAGELWGGDVDPGALTVSQL
KGAMTNEVFRITWPGGEGDPRKVLVRIYGQGVEVFFDRADEVRTFECMSRHGQGPRLLGR
FANGRVEEFINARTLSAADLRDPEISALIAKKLREFNDLDMPGPKNVSLWQRLRRWLEEA
RGRCSEEESKQFQLNKVGDEIAVLEKALSRVDQTVGFCHNDLQYGNIMIYEETRQVTLID
YEYASFNPVAFDIANHFCEMAADYHTATPHVLDFTKYPDTEEQRRFVQTYLSSSGEKPSD
EEVENLLGLIAKYTLASHLFWGLWGIISAHVNKNIDFEYMEYARQRFDQYWQTKPRILGA
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgtggacccgccgccgcgcggggaggccaccgcggccgcccccgcgcccgtg
ctgaggcggagcgccagcatcgagcgcatcccggaggacgcgcgccgcatcctgcaccgc
ctcgccggcgagctctggggcggcgacgtggacccgggcgcgctcaccgtgtcccagctc
aagggcgccatgaccaacgaggtcttccggatcacctggcccggcggcgagggcgacccg
cgcaaggtgctcgtgcgcatttacggccagggcgtcgaggtcttcttcgaccgcgccgac
gaggtccgcaccttcgagtgcatgtcgcgccacggccaggggccccgcctcctcggccgg
ttcgccaacggccgcgtcgaggagttcatcaacgccaggacgctatctgcggcggatctg
cgcgacccggagatatctgccctgattgccaagaagctgagggagtttaacgatctcgac
atgcctggacccaagaatgtctcattgtggcagaggctcaggaggtggcttgaggaggct
cgtggcaggtgttctgaggaagagtccaagcaatttcagctgaataaggtaggtgatgag
attgccgtgctggagaaggcactgtccagggtcgatcagacagtgggattttgccataat
gatctgcagtatgggaatattatgatatatgaagagaccagacaagtcaccttgattgac
tatgaatatgccagctttaaccctgttgcatttgacattgctaatcacttttgtgagatg
gctgcggattaccatactgcaacaccacacgtgttggattttacgaaatatcctgacact
gaggagcagcgaagatttgttcagacataccttagttcttcaggtgaaaagccatcagat
gaggaagttgaaaacctactagggttgattgcaaagtacacacttgcaagccatctgttt
tggggcctttggggaataatctcggcgcacgtgaacaaaaatatcgacttcgagtacatg
gagtatgcaaggcaacgcttcgatcagtactggcagacaaagcctagaatacttggagcc
aactga

DBGET integrated database retrieval system